Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
ALPP; PLAP; Alkaline phosphatase, placental type; Alkaline phosphatase Regan isozyme; Placental alkaline phosphatase 1; PLAP-1
Species
Homo sapiens (Human)
Expression Region
117-447aa
Target Protein Sequence
TATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAV
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant human ALPP protein is encoded by a recombinant DNA that was cloned into the expression vector and then transformed into the Baculovirus that supports the expression of the gene. The recombinant DNA was constructed by fusing the N-terminal 10xHis tag gene to the gene fragment coding for the 117-447aa of the human ALPP protein. After purification, the product is the recombinant human ALPP protein. This recombinant ALPP protein was subjected to the SDS-PAGE determination. Its purity reaches over 85% evaluated by Bandscan software analysis combined with SAS-PAGE. This ALPP protein ran to the molecular weight of about 40 kDa under SDS-PAGE condition.
ALPP (or PLAP) protein is an allosteric enzyme encoded by the ALPP gene. ALPP belongs to a multigene family composed of four alkaline phosphatase isoenzymes. ALPP is a membrane-bound glycosylated dimeric enzyme, which is mainly presented on the placental and endometrial tissue. It usually functions as a homodimer. At present, the ALPP protein has been discovered involvement in coronavirus biology, which is relevant for disease process. As identified tumor target, ALPP participates in the progress of tumors like seminoma and ovarian cancer.
