Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Tags & Cell Markers
Alternative Names
ALPP; PLAP; Alkaline phosphatase, placental type; Alkaline phosphatase Regan isozyme; Placental alkaline phosphatase 1; PLAP-1
Species
Homo sapiens (Human)
Expression Region
117-447aa
Target Protein Sequence
TATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAV
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 117-447 constitute the expression domain of recombinant Human ALPP. The theoretical molecular weight of the ALPP protein is 41.9 kDa. This protein is generated in a e.coli-based system. The N-terminal 10xHis tag was fused into the coding gene segment of ALPP, making it easier to detect and purify the ALPP recombinant protein in the later stages of expression and purification.
Alkaline phosphatase, placental type (ALPP) is mainly expressed in the placenta, making it a significant subject of research. One of the most prominent areas of investigation is the biological role of ALPP during the pregnancy process. Researchers focus on understanding the functions of ALPP in placental development, maintaining pregnancy stability, and embryo implantation to gain insights into its regulatory mechanisms in the process of gestation. In addition, ALPP is associated with some pregnancy-related disorders, such as preterm birth and pregnancy-induced hypertension. Scientists are dedicated to exploring the role of ALPP in the pathogenesis of these disorders, providing new perspectives for the prevention and treatment of related diseases in the future.