Recombinant Human Alkaline phosphatase, placental type (ALPP), partial

In Stock
Code CSB-EP001632HU1
Abbreviation Recombinant Human ALPP protein, partial
MSDS
Size US$256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Tags & Cell Markers
Alternative Names
ALPP; PLAP; Alkaline phosphatase, placental type; Alkaline phosphatase Regan isozyme; Placental alkaline phosphatase 1; PLAP-1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
117-447aa
Target Protein Sequence
TATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.9 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 117-447 constitute the expression domain of recombinant Human ALPP. The theoretical molecular weight of the ALPP protein is 41.9 kDa. This protein is generated in a e.coli-based system. The N-terminal 10xHis tag was fused into the coding gene segment of ALPP, making it easier to detect and purify the ALPP recombinant protein in the later stages of expression and purification.

Alkaline phosphatase, placental type (ALPP) is mainly expressed in the placenta, making it a significant subject of research. One of the most prominent areas of investigation is the biological role of ALPP during the pregnancy process. Researchers focus on understanding the functions of ALPP in placental development, maintaining pregnancy stability, and embryo implantation to gain insights into its regulatory mechanisms in the process of gestation. In addition, ALPP is associated with some pregnancy-related disorders, such as preterm birth and pregnancy-induced hypertension. Scientists are dedicated to exploring the role of ALPP in the pathogenesis of these disorders, providing new perspectives for the prevention and treatment of related diseases in the future.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Alkaline phosphatase that can hydrolyze various phosphate compounds.
Gene References into Functions
  1. This meta-analysis suggests that high serum ALP level is obviously associated with lower OS rate in patients with osteosarcoma, and it is an effective biomarker of prognosis. PMID: 29970708
  2. Concentrations of PLAP were elevated in gingival crevicular fluid of patients with pre-eclampsia. PMID: 26988336
  3. SALL4 also outperformed PLAP on a small sample of cytology blocks. Although SALL4 is not entirely specific, it is a highly sensitive marker with strong diffuse nuclear reactivity in the majority of MGCTs in the posttreatment setting, at significantly higher levels than PLAP PMID: 25906119
  4. Quantum-mechanical computational methods were employed to study the catalytic mechanism of human placental AP (PLAP). An active-site model was used, constructed on the basis of the X-ray crystal structure of the enzyme. PMID: 25409280
  5. term placental explants, but not their conditioned medium, can de-phosphorylate IGFBP-1 through the action of placental alkaline phosphatase PMID: 24856042
  6. Anti-PLAP antibodies may serve as a modular building blocks for the development of targeted therapeutic products, armed with cytotoxic drugs, radionuclides or cytokines as payloads. PMID: 24247025
  7. A candidate gene, ALPP, encoding the placental alkaline phosphatase, was identified as being potentially involved in recurrent spontaneous abortion. PMID: 24296104
  8. The objective of the following study was to record the specificity and sensitivity of alpha5(IV) loss, smoothelin expression and PLAP expression as markers of gastrointestinal smooth muscle neoplasms PMID: 24043717
  9. Data indicate that p180 is required for the efficient targeting of placental alkaline phosphatase (ALPP) mRNA to the endoplasmic reticulum (ER). PMID: 24019514
  10. Calculation of the electrostatic potentials within the active site of human placental alkaline phosphatase also suggests that the local positive electrostatic environment may account for its capability to distinguish various substrates PMID: 21910833
  11. High serum alkaline phosphatase cooperating with MMP-9 is associated with metastasis in patients with primary osteosarcoma. PMID: 22333159
  12. PLAP exerts a positive effect on DNA replication and acts as a proliferative factor in trophoblastic cells. PMID: 21868091
  13. The proximity of undifferentiated gonadal tissue with the tumors as well as the immunostaining patterns (PLAP+, OCT3/4+, and CD117/KIT+) suggests that germ cells found in them are a risk factor for gonadal tumors. PMID: 21692598
  14. the catalytic mechanism of human placental alkaline phosphatase PMID: 21939286
  15. Data show that serum alkaline phosphatase, Gleason score, and intensity of bone metastasis are important and statistically significant prognostic factors, and affects time to progression and life time. PMID: 19450995
  16. at a certain time point during adrenocortical development, some fetal zone cells survive owing to defective apoptosis and develop into childhood ACT, maintaining some characteristics of the embryonal period, such as PLAP expression PMID: 21516013
  17. Serum total calcium (r -0.1362, p<0.001), serum inorganic phosphate (r -0.45, p<0.001) and serum alkaline phosphatase (r -0.5587, p<0.001) have shown inverse relationship with age. PMID: 20655896
  18. High serum alkaline phosphatase is associated with chronic kidney disease. PMID: 20299338
  19. differential expression of Pl(1) and Pl(2) probably results from linkage disequilibrium with the sequence variation rs2014683G>A in the ALPP gene promoter that was shown to have allele-specific binding patterns to placental nuclear proteins. PMID: 20663553
  20. structure of placental alkaline phosphatase with pNPP contained only p-nitrophenol in three distinct sites, while the structure with 5'-AMP contained the p-nitrophenyl group in two of the sites instead of 5'-AMP PMID: 20693656
  21. Low magnitudes of tensile strain enhance expression of alkaline phosphatase in human osteoblasts. PMID: 19595020
  22. The PLAP D allele contains two amino acid substitutions: P209R (692C>G) and E429G (1352 A>G). PMID: 11857742
  23. Proximity of the protein moiety of a GPI-anchored protein to the membrane surface: a FRET study. PMID: 12081485
  24. the beta-N-acetylglucosaminyl phosphate diester residue is attached to the glycosylphosphatidylinositol anchor of human placental alkaline phosphatase and is a target of the channel-forming toxin aerolysin PMID: 12851398
  25. receptor for Aeromonas sobria hemolysin. PMID: 15715171
  26. analysis of human placental alkaline phosphatase in complex with functional ligands PMID: 15946677
  27. The effect of parity on placental weight and birth weight is examined through a series of birth records from an Indian population in Calcutta. PMID: 16431676
  28. crystal structure of strontium-substituted human placental alkaline phosphatase shows that strontium substitutes the calcium ion with concomitant modification of the metal coordination PMID: 16815919
  29. activity of GPI-anchored enzymes may be modulated by membrane microenvironment features PMID: 18416535
  30. Serum bilirubin, alkaline phosphatase, and aspartate aminotransferase are an efficient set of biochemistries to identify UDCA-treated patients with primary biliary cirrhosis at risk of death or liver transplantation (LT). PMID: 18752324
  31. Elevations of alkaline phosphatase is associated with therapy related pediatric cancer. PMID: 18802949

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Protein Families
Alkaline phosphatase family
Tissue Specificity
Detected in placenta (at protein level).
Database Links

HGNC: 439

OMIM: 171800

KEGG: hsa:250

STRING: 9606.ENSP00000375881

UniGene: Hs.284255

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*