Recombinant Human Aminopeptidase N (ANPEP), partial

In Stock
Code CSB-EP001827HU1
Abbreviation Recombinant Human ANPEP protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
AP-N;hAPN;Alanyl aminopeptidase;Aminopeptidase M;AP-M;Microsomal aminopeptidase;Myeloid plasma membrane glycoprotein CD13;gp150;CD13
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
34-219aa
Target Protein Sequence
SQEKNKNANSSPVASTTPSASATTNPASATTLDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
55.8 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Aminopeptidase N (ANPEP) is produced in E. coli with an expression region spanning amino acids 34 to 219. This partial protein carries an N-terminal 10xHis-GST tag and a C-terminal Myc tag, which help with purification and detection. The purity exceeds 85%, as verified by SDS-PAGE analysis, ensuring reliable performance in research applications.

Aminopeptidase N (ANPEP) is an enzyme that appears to play a significant role in peptide substrate metabolism. It cleaves amino acids from the N-terminus of peptide chains—a process that seems important for protein maturation and recycling. ANPEP also participates in various cellular pathways, making it a valuable research target for studying enzymatic function and regulation.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Human ANPEP is a type II membrane glycoprotein that requires precise folding, disulfide bond formation, and extensive glycosylation for its functional enzymatic activity. The E. coli expression system cannot provide the necessary eukaryotic post-translational modifications (particularly glycosylation) and complex folding environment required for this membrane-associated protein. The large N-terminal 10xHis-GST tag (∼26 kDa) may sterically interfere with the protein's functional domains, while the partial fragment (34-219aa) lacks the complete structural context. The probability of correct folding with enzymatic activity is very low.

1. Antibody Development and Validation Studies

Antibody development relies on antigenic sequence recognition rather than functional folding or glycosylation. This recombinant ANPEP fragment serves as an excellent immunogen for generating antibodies against linear epitopes of human aminopeptidase N. The partial sequence provides substantial epitope coverage for antibody production. However, antibodies may not efficiently recognize conformational or glycosylation-dependent epitopes on the native, properly folded protein found in physiological conditions.

2. Structural and Biophysical Characterization

Basic biophysical characterization can be performed to assess the protein's physical properties. Techniques like circular dichroism spectroscopy can analyze secondary structure content, while size-exclusion chromatography can determine oligomeric state. However, these studies will characterize a non-glycosylated, misfolded protein rather than the native, glycosylated enzyme.

3. Tag-Based Detection System Development

Tag-based detection relies on tag antigenicity rather than native protein folding. The combination of His, GST, and Myc tags makes this protein valuable for developing and optimizing multi-tag detection systems. The protein serves as an excellent positive control for testing antibody specificity and assay development.

Final Recommendation & Action Plan

The E. coli expression system is fundamentally unsuitable for producing a functional version of this complex membrane glycoprotein due to its glycosylation requirements and membrane association needs. This recombinant ANPEP fragment is primarily suitable for antibody development against linear epitopes (Application 1) and tag-based detection system development (Application 3). Avoid interaction studies entirely due to the high probability of misfolding. Protein-protein interactions require precise tertiary structure and proper glycosylation, which this bacterially expressed fragment cannot provide. Application 2 (biophysical characterization) can provide basic physical property data, but will not reflect native protein characteristics. For reliable ANPEP functional studies, use mammalian expression systems that support proper glycosylation and membrane targeting, or work with native protein purified from biological sources where correct post-translational modifications are preserved. Begin with basic biophysical characterization to confirm protein integrity, then proceed with linear epitope antibody production and tag-based assay development. All functional applications require alternative protein sources with proper glycosylation and membrane association.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Broad specificity aminopeptidase which plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Also involved in the processing of various peptides including peptide hormones, such as angiotensin III and IV, neuropeptides, and chemokines. May also be involved the cleavage of peptides bound to major histocompatibility complex class II molecules of antigen presenting cells. May have a role in angiogenesis and promote cholesterol crystallization. May have a role in amino acid transport by acting as binding partner of amino acid transporter SLC6A19 and regulating its activity.; (Microbial infection) Acts as a receptor for human coronavirus 229E/HCoV-229E. In case of human coronavirus 229E (HCoV-229E) infection, serves as receptor for HCoV-229E spike glycoprotein.; (Microbial infection) Mediates as well Human cytomegalovirus (HCMV) infection.
Gene References into Functions
  1. Crosslinking of CD13 by mAb C or E is required to inhibit adhesion, as monovalent Fab fragments are not sufficient. Thus, C and E antibodies recognize a distinct epitope on CD13, and binding to this epitope interferes with both CD13-mediated cell adhesion and enzymatic activity. PMID: 29789790
  2. Data indicate the expression of aminopeptidase N (CD13) in small cell lung cancer (SCLC) tumor and suggest pre-therapeutic CD13 analysis for testing as investigational predictive biomarker for patient selection. PMID: 29110838
  3. CD13 may be a marker for onychofibroblasts within nail matrix onychodermis PMID: 28708295
  4. This is the first report presenting CD13 and FLI1 as important mediators of resistance to BRAF inhibition with potential as drug targets in BRAF inhibitors refractory melanoma. PMID: 29048432
  5. CD13 enrichment was correlated with early recurrences, and poor prognosis in patients with hepatocellular carcinoma. PMID: 29145632
  6. Patients with acute myeloid leukemia developing leukemia-specific acute hypoxic respiratory failure within 15 days had higher CD13 expression by leukemic cells. PMID: 28323433
  7. Data suggest that CNGRC-GG-D(KLAKLAK)2 peptide actively participates in the downregulation of aminopeptidase N/CD13. PMID: 26655501
  8. CGRP and IL-4 positively regulated APN/CD13 expression and activity in psoriatic fibroblasts. PMID: 28387421
  9. this study shows that CD13 significantly contributes to tissue infiltration by monocytic myeloid-derived suppressor cells and monocytes, thereby contributing to the pathogenesis of hepatic inflammation PMID: 28739875
  10. data reveal a novel role for CD13 in inducing homotypic aggregation in neutrophils, which results in a transmigration deficiency; this mechanism may be relevant to neutrophil micro-aggregation in vivo PMID: 27467268
  11. CD13 expression is associated with hepatoblastoma invasiveness and could be a novel prognostic marker for hepatoblastoma. PMID: 25682862
  12. Data indicate that fluorogenic substrates can be successfully used to identify aminopeptidase N and to measure their activity in cell lysates. PMID: 26449746
  13. Data show that CD13 anntigen and receptor tyrosine kinase-like orphan receptor 2 (ROR2) identify a cardiac lineage precursor pool that is capable of successful engraftment into the porcine heart. PMID: 26771355
  14. The substrate Angiotensin II, the enzymes aminopeptidases-A, B, M as well as IRAP were detected in the jejunal mucosa. PMID: 26311161
  15. 14-3-3epsilon might directly bind to CD13, which transmits its signal in chondrocytes to induce a catabolic phenotype similar to that observed in osteoarthritis. PMID: 26208633
  16. Alanyl aminopeptidase expression is confined to mature zymogenic chief cells and its expression is lost en route to metaplasia. PMID: 26514774
  17. Aminopeptidase N activity in tissue and plasma from colorectal cancer patients is an independent prognostic factor of 5-year survival. PMID: 25929234
  18. Expression of APN/CD13 is a potential unfavorable factor to predict the efficacy and prognosis of post-operative chemotherapy in NSCLC patients, especially in lung adenocarcinoma patients. PMID: 25879366
  19. We identified a unique HCC line, Li-7, which not only shows heterogeneity for a CD13(+) CSC hierarchy, but also undergoes a "population change" upon CSC differentiation PMID: 25885470
  20. This study permitted the identification of the novel human LAP1C isoform and partially unraveled the molecular basis of LAP1 regulation. PMID: 25461922
  21. Together these experiments reveal potential enzymatic and signalling roles for APN in osteosarcoma and establish a starting point for an in-depth analysis of the role of APN in regulating invasiveness. PMID: 25340499
  22. Postulate that the interaction of ADAM17 with CD13 and its downregulation following CD13 engagement has important implications in acute myeloid leukemia cells. PMID: 25246708
  23. CD13 could play an important role as a T cell chemoattractant, in a positive feedback loop that contributes to rheumatoid arthritis synovitis. PMID: 25219368
  24. This study showed that CD13 and CD33 expression associated with poor prognosis in patients with MM implicating the need of analysis of these markers in MM diagnosis. PMID: 24991573
  25. Aberrant expression of CD13 in >/= 5% of blasts of patients with SR-aALL is an adverse prognostic factor, delineating a subgroup of patients with SR-aALL that should be considered for more aggressive treatment. PMID: 24411984
  26. Molecular mechanisms regulating CD13-mediated adhesion. PMID: 24627994
  27. CD13 participates in phagocytic processes in dendritic cells and macrophages. PMID: 24063007
  28. Antigen CD13, by influencing the adipogenic potential of human amniotic mesenchymal stem cells, could be an in utero risk factor for obesity. PMID: 23488598
  29. NGR-LDP could bind to CD13-expressing HT-1080 cells. PMID: 23206754
  30. results indicate that APN/CD13 could be an important diagnostic biomarker and therapeutic target for Malignant fibrous histiocytoma . PMID: 23677132
  31. Activities of aminopeptidases N and B and insulin-regulated aminopeptidase could be useful non-invasive biomarkers of Alzheimer's disease from the earliest stages. PMID: 23500679
  32. High CD13 expression is associated with Philadelphia chromosome negative B cell acute lymphoblastic leukemia. PMID: 23643324
  33. results showed that ANPEP downregulation in prostate cancer (PC) was frequently associated with aberrant promoter hypermethylation, suggesting that epigenetic mechanisms are involved in silencing of ANPEP in PC cells PMID: 23322201
  34. CD13 expression plays a role in supporting the survival of cancer stem cells and that there is an epithelial-mesenchymal transition-associated reduction in reactive oxygen species elevation. PMID: 21879266
  35. The hAPN crystal structure provides the first example of a dimeric M1 family member and the observed structural features provide novel insights into the mechanism of peptide processing and signal transduction. PMID: 22932899
  36. Inhibiting CD13 with bestatin may enhance the differentiation-inducing activity of all-trans-retinoic acid in NB4 cells. PMID: 22040956
  37. Coexpression of APN/CD13 correlated significantly with tumor type and neoangiogenesis in breast cancer. PMID: 21611838
  38. Myeloid cell surface peptidase CD13 is highly and specifically expressed on a subset of dendritic cells (DCs) responsible for cross-presentation: transgenic CD8+ murine splenic DCs. PMID: 22544935
  39. The overall effects of APN on the expression of fibronectin, tenascin-C, and MMPs in fibroblasts propose an important role for APN in the regulation of keratinocyte-mediated ECM remodeling and fibroblast contractile activity. PMID: 22065384
  40. Staining of tissue microarrays generated from a large series of melanoma samples and control tissues demonstrated a higher APN expression in primary melanoma lesions when compared with nevi and metastases PMID: 22307972
  41. A peptide-targeted gene vector for highly efficient receptor-mediated intracellular delivery is used to target gene loaded poly(lactic acid)-poly(ethylene glycol) nanoparticles to vascular endothelial cells overexpressing CD13. PMID: 21376765
  42. Murine gamma-herpesvirus-68 glycoprotein (gp)150-specific T-cell receptor epitope transgene activates antiviral CD4+ T cells that are maintained throughout long-term infection and even during quiescent latency. PMID: 22079983
  43. We identified a variant in each of 3 genes (RFC1, SCN1A, ANPEP) potentially implicated in susceptibility to severe neurological complications in West Nile Virus disease. PMID: 21881118
  44. APN expression and enzymatic function is reduced in aggressive meningiomas, and that alterations in the balance between APN and SPARC might favor meningioma invasion PMID: 19236378
  45. analysis of the critical role of flanking residues in NGR-to-isoDGR transition and CD13/integrin receptor switching PMID: 20064928
  46. Stromal aminopeptidase N expression correlates with angiogenesis in non-small-cell lung cancer. PMID: 19908113
  47. data demonstrate that the glycosylation of aminopeptidase N at N291 blocks human coronavirus-229E infection PMID: 11774469
  48. tested the hypothesis that CD13 influences proliferation of monocytoid cells by retarding the velocity of the cell cycle PMID: 11999577
  49. CD13/APN is an important target of Ras signaling in angiogenesis and is a limiting factor in angiogenic progression. PMID: 12406907
  50. inhibiting CD13/aminopeptidase N on the cell-surface of acute promyelocytic leukemia cells increases ATRA-induced differentiation PMID: 12443882

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein.
Protein Families
Peptidase M1 family
Tissue Specificity
Expressed in epithelial cells of the kidney, intestine, and respiratory tract; granulocytes, monocytes, fibroblasts, endothelial cells, cerebral pericytes at the blood-brain barrier, synaptic membranes of cells in the CNS. Also expressed in endometrial st
Database Links

HGNC: 500

OMIM: 151530

KEGG: hsa:290

STRING: 9606.ENSP00000300060

UniGene: Hs.1239

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*