Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

GDF10

Uniprot No.

P55107

Research Area

Cancer

Alternative Names

(GDF-10)(Bone morphogenetic protein 3B)(BMP-3B)(Bone-inducing protein)(BIP)

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

369-478aa

Target Protein Sequence

QWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVDTCACR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

16.1 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Human GDF10 protein production is achieved through the manipulation of desired gene expression in e.coli cells. The sequence (369-478aa) of foreign DNA is fused to an expression vector and then transformed into e.coli cells. The positive cells are selected and cultured to induce the expression of the desired protein. A N-terminal 10xHis tag is fused to the protein. The recombinant Human GDF10 protein is subjected to affinity purification. Its purity is over 90%, as measured by SDS-PAGE.

Target Background

Function

Growth factor involved in osteogenesis and adipogenesis. Plays an inhibitory role in the process of osteoblast differentiation via SMAD2/3 pathway. Plays an inhibitory role in the process of adipogenesis.

Gene References into Functions

Study shows that GDF10 is down-regulated in patients with oral squamous cell carcinoma, and is an independent risk factor for overall survival. Its expression is regulated by TGFBR3 which shares the signaling inhibiting epithelial-mesenchymal transition. PMID: 25728212
GDF10 is a stroke-induced signal for axonal sprouting and functional recovery. PMID: 26502261
new hypoxia-inducible and SOX9-regulated genes, Gdf10 and Chm-I. In addition, Mig6 and InhbA were induced by hypoxia, predominantly via HIF-2alpha PMID: 18077449
BMP3b and BMP6 genes were suppressed by DNA methylation and methylation of BMP3b is significantly frequent in Japanese malignant pleural mesotheliomas (MPMs), suggesting its pathogenic role and the ethnic difference in MPMs. PMID: 18949431

Subcellular Location

Secreted.

Protein Families

TGF-beta family

Tissue Specificity

Expressed in femur, brain, lung, skeletal muscle, pancreas and testis.

Database Links

HGNC: 4215

OMIM: 601361

KEGG: hsa:2662

STRING: 9606.ENSP00000224605

UniGene: Hs.2171

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
If CAPTCHA verification fails, click to refresh the CAPTCHA and try again.

Code	CSB-EP009343HU
Abbreviation	Recombinant Human GDF10 protein
MSDS	MSDS Datasheet
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Bone morphogenetic protein 3B (GDF10)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage