Recombinant Human Bone morphogenetic protein 3B (GDF10)

In Stock
Code CSB-EP009343HU
Abbreviation Recombinant Human GDF10 protein
MSDS
Size $306
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
GDF10
Uniprot No.
Research Area
Cancer
Alternative Names
(GDF-10)(Bone morphogenetic protein 3B)(BMP-3B)(Bone-inducing protein)(BIP)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
369-478aa
Target Protein Sequence
QWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVDTCACR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
16.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Human GDF10 protein production is achieved through the manipulation of desired gene expression in e.coli cells. The sequence (369-478aa) of foreign DNA is fused to an expression vector and then transformed into e.coli cells. The positive cells are selected and cultured to induce the expression of the desired protein. A N-terminal 10xHis tag is fused to the protein. The recombinant Human GDF10 protein is subjected to affinity purification. Its purity is over 90%, as measured by SDS-PAGE.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Growth factor involved in osteogenesis and adipogenesis. Plays an inhibitory role in the process of osteoblast differentiation via SMAD2/3 pathway. Plays an inhibitory role in the process of adipogenesis.
Gene References into Functions
  1. Study shows that GDF10 is down-regulated in patients with oral squamous cell carcinoma, and is an independent risk factor for overall survival. Its expression is regulated by TGFBR3 which shares the signaling inhibiting epithelial-mesenchymal transition. PMID: 25728212
  2. GDF10 is a stroke-induced signal for axonal sprouting and functional recovery. PMID: 26502261
  3. new hypoxia-inducible and SOX9-regulated genes, Gdf10 and Chm-I. In addition, Mig6 and InhbA were induced by hypoxia, predominantly via HIF-2alpha PMID: 18077449
  4. BMP3b and BMP6 genes were suppressed by DNA methylation and methylation of BMP3b is significantly frequent in Japanese malignant pleural mesotheliomas (MPMs), suggesting its pathogenic role and the ethnic difference in MPMs. PMID: 18949431
Subcellular Location
Secreted.
Protein Families
TGF-beta family
Tissue Specificity
Expressed in femur, brain, lung, skeletal muscle, pancreas and testis.
Database Links

HGNC: 4215

OMIM: 601361

KEGG: hsa:2662

STRING: 9606.ENSP00000224605

UniGene: Hs.2171

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*