Recombinant Human C-C motif chemokine 16(CCL16)

Code CSB-EP004779HUg4
Size $1726Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Target Names CCL16
Uniprot No. O15467
Research Area Immunology
Alternative Names Chemokine CC-4 ;HCC-4;Chemokine LEC;IL-10-inducible chemokine;LCC-1;Liver-expressed chemokineLymphocyte and monocyte chemoattractant ;LMCMonotactin-1 ;MTN-1NCC-4;Small-inducible cytokine A16
Species Homo sapiens (Human)
Source E.coli
Expression Region 24-120aa
Target Protein Sequence QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 13.8 kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 10xHis-HA-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time 13-23 business days
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Background

Function
(From Uniprot)
Shows chemotactic activity for lymphocytes and monocytes but not neutrophils. Also shows potent myelosuppressive activity, suppresses proliferation of myeloid progenitor cells. Recombinant SCYA16 shows chemotactic activity for monocytes and THP-1 monocytes, but not for resting lymphocytes and neutrophils. Induces a calcium flux in THP-1 cells that were desensitized by prior expression to RANTES.
Gene References into Functions
  1. Overexpression of miR-1247 may alleviate LPS-induced A549 cell injury through targeting CCL16. PMID: 29768218
  2. Single nucleotide polymorphism (SNPs) located in and around the C-C motif chemokine ligand 16 (CCL16) gene are associated with CCL16 protein levels in blood plasma, and rs80329614 is the SNP most strongly associated with CCL16 protein levels in plasma. PMID: 27357396
  3. High umbilical artery CCL16 is prominently detected in preterm preeclamptic pregnancies with severe growth restriction. PMID: 22857868
  4. Data show that CCL-16 gene expression was upregulated by 7.46-fold in IBS patients when compared with controls and suggest a subclinical inflammatory component underlying IBS. PMID: 21951809
  5. Low umbilical cord blood chemokine CCL16 associates with spontaneous preterm birth PMID: 21288736
  6. Recombinant CCL16 significantly enhances the effector and the antigen-presenting function of macrophages and augments T cell lytic activity. PMID: 14525962
  7. An adenoviral vector encoding human CCL16 injected into mice with pre-established mammary carcinoma induces strong antitumor response; when given before surgical excision of primary lesions, the treatment prevents metastatic spread and cures 63% of mice. PMID: 15034014
  8. CCL16 induced efficient migratory responses in human and mouse eosinophils. CCL16 is a novel functional ligand for H4 and may have a role in trafficking of eosinophils. PMID: 15265943
  9. CC chemokine-4 (HCC-4)/CCL16 transduces signals differently from other CCR1-dependent chemokines and may play different roles in the immune response. PMID: 16226254
  10. Elevated concentrations in bronchoalveolar lavage fluid from patients with eosinophilic pneumonia PMID: 19494526

Show More

Hide All

Subcellular Location Secreted
Protein Families Intercrine beta (chemokine CC) family
Tissue Specificity Mainly expressed in liver, also found in spleen and thymus. Highly expressed in LPS- and IFN-gamma-activated monocytes, weakly in some lymphocytes, including natural killer cells, gamma-delta T-cells, and some T-cell clones.
Database Links

HGNC: 10614

OMIM: 601394

KEGG: hsa:6360

STRING: 9606.ENSP00000293275

UniGene: Hs.10458

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1