Recombinant Human C-X-C chemokine receptor type 3 (CXCR3), partial

In Stock
Code CSB-EP006253HU1
Abbreviation Recombinant Human CXCR3 protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
CXCR3; GPR9; C-X-C chemokine receptor type 3; CXC-R3; CXCR-3; CKR-L2; G protein-coupled receptor 9; Interferon-inducible protein 10 receptor; IP-10 receptor; CD antigen CD183
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
4-50aa
Target Protein Sequence
EVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.6 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of human mesangial cells (HMC) through a heterotrimeric G-protein signaling pathway. Binds to CCL21. Probably promotes cell chemotaxis response.; Receptor for the C-X-C chemokine CXCL4 and also mediates the inhibitory activities of CXCL9, CXCL10 and CXCL11 on the proliferation, survival and angiogenic activity of human microvascular endothelial cells (HMVEC) through a cAMP-mediated signaling pathway. Does not promote cell chemotaxis respons. Interaction with CXCL4 or CXCL10 leads to activation of the p38MAPK pathway and contributes to inhibition of angiogenesis. Overexpression in renal cancer cells down-regulates expression of the anti-apoptotic protein HMOX1 and promotes apoptosis.; Mediates the activity of CXCL11.
Gene References into Functions
  1. High CXCR3 expression is associated with invasion and metastasis in tongue squamous cell carcinoma. PMID: 29286143
  2. Up-regulated CXCR3 is detectable in the amniotic fluid and associated with the presence of placental lesions consistent with maternal anti-fetal rejection so may serve as a potential marker of spontaneous preterm delivery. PMID: 28829757
  3. the expression of chemokine receptors in different peripheral blood T-cell subsets in patients with polymyositis (PM) and dermatomyositis, was examined. PMID: 28869080
  4. Results suggest that infiltration of chemokine (C-X-C motif) receptor 3 (CXCR3)-positive plasma cells is a characteristic feature of Hunner type interstitial cystitis (HIC). PMID: 27339056
  5. Results of this study indicate that CXCR3 overexpression in GC is associated with increased DC and TIL infiltration and improved OS. PMID: 29266971
  6. Following activation with T-cell receptor and co-culture with various concentrations of chrysotile fibers using freshly isolated CD4+ surface CXCR3 positive and negative fractions, the intracellular expression of CXCR3, IFNgamma and IL-17 remained unchanged when co-cultured with chrysotile. PMID: 28498408
  7. In conclusion, it seems that decreased expression of CXCR3 and higher expression of CCR6 were associated with HTLV-1 infection, what indicate that these alterations may favor virus dissemination but not disease manifestation. PMID: 28206670
  8. Alternatively spliced variant of CXCR3 mediates the metastasis of liver cancer. PMID: 26883105
  9. The CXCL4 monomer acts as the minimal active unit for interacting with CXCR3 N-Terminal Sulfated Peptide, and sulfation of N-terminal tyrosine residues on the receptor is important for binding. PMID: 28945356
  10. approach has been able to describe the structural events which dynamically characterize the molecular mechanisms involved in the binding of CXCR3 to CXCL11 and the critical role exerted by its N-terminal region in "hunting" and capturing the ligand. PMID: 29054054
  11. High CXCR3 expression is associated with chronic lymphocytic leukaemia in comparison to small lymphocytic lymphoma. PMID: 29153094
  12. CD4(+)CXCR3(+) T cells are highly enriched in the inflamed mucosa of intestinal bowel disease patients. PMID: 26732675
  13. Up-regulation of CXCR3 chemokine and its ligands in bronchoalveolar lavage fluid during organizing pneumonia increases the risk of chronic lung allograft dysfunction after lung transplantation. PMID: 28686641
  14. These data suggest that elevated IP-10 levels may impair NK cell function during HIV infection and that IP-10/CXCR3 blocking may be a novel therapeutic strategy in the control and functional cure of HIV. PMID: 28465448
  15. Our result showed that CXCR2 expression was correlated with high grade (P = 0.024), advanced stage (P = 0.029) and metastasis (P = 0.018). The log-rank test revealed that high CXCR2 and CXCR3 expressions are related to poorer overall survival (P < 0.001; P < 0.001). PMID: 27273823
  16. The percentage of CXCR3(+) CD4(+) TEM cells negatively correlated with the severity of the cutaneous disease in psoriasis patients. Importantly CLA(+) CD4(+) TCM cells expressing CCR6(+) or CCR4(+)CXCR3(+) negatively correlated with psoriasis severity suggesting recruitment to the skin compartment. PMID: 28392462
  17. Our studies suggest that CXCR3 is a key contributor to the pathogenesis of Alopecia areata by mediating the infiltration of autoreactive CD8+NKG2D+ T cells into the skin PMID: 27412416
  18. TNF-alpha augments CXCR2 and CXCR3 to promote the progression of renal cell carcinoma leading to a poor prognosis. PMID: 27297979
  19. TNF-alpha upregulated the expression of CXCR3 in HUVECs PMID: 27565063
  20. TLR9 ligands may contribute to the immunopathogenesis of sarcoidosis via induction of CXCL10 release in the alveolar macrophages. PMID: 27390897
  21. The CXCL10/CXCR3 axis mediates T-cell recruitment into the skin in progressive vitiligo. Blocking this chemotactic mechanism may present a new form of therapy. PMID: 26801009
  22. these data suggest that CXCR3A contributes to the growth, invasion and metastasis of gastric cancer cells in vitro and in vivo, and thus may be a key mediator of gastric cancer progression. PMID: 27461521
  23. IP-10 complexes with CXCR3, which in turn activates the ERK1/2 pathway, thus resulting in upregulation of p-CREB and increased vascular smooth muscle cell proliferation. PMID: 28111710
  24. the CXCR3+/CCR5+ expression was higher in the neoplastic as compared to the hyperplastic nodules. PMID: 27872865
  25. monocytes and lymphocytes cooperate to enhance migration towards CXCR3 chemokines and CCL5 in COPD PMID: 26965295
  26. CXCL10/CXCR3 axis promotes gastric cancer cell invasion and migration by upregulating MMP-2 and MMP-9 production via PI3K/AKT pathway. PMID: 27470388
  27. CXCR3 expression in chronic lymphocytic leukemia cells was a strong determinant of a worse clinical outcome. PMID: 26589908
  28. Speculate that aberrant expression of CXCR3 in marginal zone lymphoma of the skin is associated with migration of lymphoma cells to the epidermis and could lead to an epidermotropic pattern. PMID: 26275313
  29. CXCR3 role in autoimmune thyroiditis [review] PMID: 24999582
  30. Both CXCL10 and CXCR3 appeared to be useful in differentiating T1R reaction in borderline leprosy while CXCR3 alone differentiated BT from BT-T1R PMID: 26831417
  31. CXCR3 expression was upregulated in advanced gastric cancer and was associated with increased CD4+, CD8+ tumor-infiltrating lymphocyte infiltration and improved overall survival PMID: 26823797
  32. CXCR3 was also linked to steatosis through inducing hepatic lipogenic genes PMID: 26394162
  33. congruent with the concept that inflammation plays a key role in the pathogenesis of LV dysfunction, MIG, IP10 and I-TAC add diagnostic accuracy over and beyond NT-pro BNP. PMID: 26506526
  34. Suggest that aberrant CXCR3 expression may play crucial roles in suppressing prostate carcinoma metastasis by inhibiting cell proliferation and invasion through the PCLbeta signaling pathway. PMID: 26339376
  35. The expression of the chemokine receptors CXCR3, CXCR4 and CXCR7 and their ligands. PMID: 26037167
  36. This study is aimed at the optimization of a new analytical method for metabolic profiling with parallel bioaffinity assessment of CXCR3 ligands of the azaquinazolinone and piperazinyl-piperidine class and their metabolites. PMID: 26164305
  37. CXCR3-A, the predominant form in hematopoietic cells, mediates tumor "go" signaling by promoting cell proliferation, survival, chemotaxis, invasion and metastasis; while CXCR3-B, on epithelial cells, mediates "stop" signaling PMID: 25663474
  38. Common variants of CXCR3 and its ligands CXCL10 and CXCL11 are associated with vascular permeability of dengue infection in peninsular Malaysia. PMID: 25858769
  39. our study suggested a potential use of CXCR3 overexpression as a prognostic marker for gastric cancer PMID: 26434630
  40. CD4+ T cells demonstrated markedly decreased CXCR3 expression. PMID: 25768944
  41. Results indicate that CXC chemokine receptors 3 (CXCR3) contributes to spontaneous preterm birth (SPTB). PMID: 26209629
  42. High expression of CXCR3 is associated with glioblastoma patients with an invasive phenotype. PMID: 25527046
  43. Report crosstalk between TGF-beta1 and CXCR3 signaling in the regulation of urethral fibrosis. PMID: 24907118
  44. Expression of CXCR3 in fibroblasts is associated with the expression of IL-13Ralpha2. PMID: 25514189
  45. Targeting of both CXCR3 isoforms may be important to block the stem cell-promoting actions of CXCR3-B, while inhibiting the pro-proliferative and metastasis-promoting functions of CXCR3-A. PMID: 25537642
  46. CXCR3 has been demonstrated to be strongly related to tumour progression in advanced colorectal cancer. PMID: 25232565
  47. CXCR3 and IP-10 are involved in the pathogenesis of bronchiolitis, and CXCR3 is associated with allergic factors. PMID: 25760840
  48. Higher percentages of CCR4+ CD4 TEM cells in acute RSV infection were accompanied with higher percentages of CXCR3+ CD8 TEM cells, whereas the development of long-lived memory CXCR3+ CD4 and CD8 TCM cells seems to be compromised PMID: 25013801
  49. the participation of the chemokine CXCL10/CXCR3 axis in celiac disease pathogenesis PMID: 24586509
  50. The different groups of clinically stable nonallergic asthmatic patients showed distinct patterns of alterations in subset distribution as well as CCR6, CXCR3, and CCR5 expression on circulating T lymphocytes. PMID: 25178112

Show More

Hide All

Subcellular Location
[Isoform 1]: Cell membrane; Multi-pass membrane protein.; [Isoform 2]: Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Isoform 1 and isoform 2 are mainly expressed in heart, kidney, liver and skeletal muscle. Isoform 1 is also expressed in placenta. Isoform 2 is expressed in endothelial cells. Expressed in T-cells (at protein level).
Database Links

HGNC: 4540

OMIM: 300574

KEGG: hsa:2833

STRING: 9606.ENSP00000362795

UniGene: Hs.198252

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*