Recombinant Human C5a anaphylatoxin chemotactic receptor (C5AR1), partial

In Stock
Code CSB-EP003996HU1
Abbreviation Recombinant Human C5AR1 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
(C5a anaphylatoxin chemotactic receptor)(C5a-R)(C5aR)(CD antigen CD88)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-37aa
Target Protein Sequence
MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.6 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-KSI-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a. The ligand interacts with at least two sites on the receptor: a high-affinity site on the extracellular N-terminus, and a second site in the transmembrane region which activates downstream signaling events. Receptor activation stimulates chemotaxis, granule enzyme release, intracellular calcium release and superoxide anion production.
Gene References into Functions
  1. the role of the active fragment complement C5a receptor (C5aR) in dental nerve regeneration in regards to local secretion of nerve growth factor (NGF) upon carious injury. PMID: 27539194
  2. X ray structure of a thermostabilized C5aR1 (known as C5aR1 StaR) in complex with NDT9513727 PMID: 29300009
  3. this study shows that C5a receptor (CD88) promotes motility and invasiveness of gastric cancer by activating RhoA PMID: 27756879
  4. Serum containing active complement enhanced pneumococcal induced proinflammatory cytokine production through C5a release and C5aR crosstalk. PMID: 27721145
  5. C5aR plays a role in T helper cell polarization induced by Mycobacterium tuberculosis and this effect is strain- and donor-dependent. PMID: 28237029
  6. Panton-Valentine leucotoxin LukS-PV/LukF-PV and the gamma-hemolysin HlgC/HlgB, bind the C5a complement-derived peptide receptor, inducing intracellular calcium release in neutrophils. PMID: 28117704
  7. TLR4 and C5aR crosstalk in dendritic cells induces a core regulatory network of RSK2, PI3Kbeta, SGK1, and FOXO transcription factors. PMID: 28733463
  8. Results showed that 7-oxygenated cholesterol derivatives have differential effects on monocyte/macrophage expression of IL-8 and C5a receptor and that C5a receptor is involved in 7alphaOHChol-induced IL-8 expression via PI3K and MEK. Study demonstrated expression of IL-8 and C5a receptor primarily by 7alpha-hydroxycholesterol in monocytes/macrophages. PMID: 28323848
  9. Reducing RPS19 in tumor cells or blocking the C5a receptor 1-RPS19 interaction decreases RPS19-mediated immunosuppression, impairs tumor growth, and delays the development of tumors in a transgenic model of breast cancer PMID: 28228558
  10. C5aR expression in gastric cancer was associated with cancer progression, liver metastasis, and poor prognosis. PMID: 27688239
  11. this study shows that downregulation of CD88 after stimulation with IL-8 is more pronounced in adults than in neonates, whereas fMLP induces changes in receptor expression that are of the same magnitude in neutrophils from neonates as from adults PMID: 27606963
  12. Relation of C5aR expression to tumor development and poor prognosis of the breast cancer patients PMID: 26494574
  13. The objective of the present study was to validate a receptor occupancy (RO) assay for a human anti-C5aR monoclonal antibody drug candidate, NNC0215-0384 (NN0384) PMID: 26084468
  14. These data thus suggest that C5aR1 acts as an enhancer of CCR5-mediated HIV entry into macrophages, the targeting of which may prove useful to reduce HIV infection by R5 strains. PMID: 26537334
  15. C5AR and C5L2-mediated neutrophil dysfunction is associated with a poor outcome in sepsis. PMID: 25726869
  16. that C5aR stimulates cell invasion and migration via ERK1/2-mediated epithelial-mesenchymal transition in hepatocellular carcinoma cells PMID: 26475622
  17. Inhibition of C5aR1 leads to a significant reduction of CD66b and CD11b expression indicating a lower neutrophil activation status and block of granule exocytosis. PMID: 26176669
  18. that rs10853784 of C5aR1 gene are associated with coronary artery disease in Han population of China PMID: 25924896
  19. 96.7% of the metastatic RCCs had C5aR expression, vs. 50.5% of the non-metastatic ones. C5a triggered ERK- and PI3Kdependent invasion of the C5aR-expressing renal carcinoma cells. The C5a-C5aR axis plays a crucial role in renal carcinoma cell invasion. PMID: 25682807
  20. These results illustrate the novel activity of the C5a-C5aR axis that promotes human NPC cell proliferation through PCAFmediated STAT3 acetylation. PMID: 25174320
  21. C5a/C5aR1 signalling plays a key role in disrupting blood-brain barrier integrity through different cascades including NF-KappaB translocation leading to altered tight junction proteins, Claudin-5 and ZO-1, and actin reorganization in the lupus setting PMID: 26059553
  22. ). Low frequency of the C5aR 450 CT genotype, which apparently is a feature of certain kidney diseases, appears to be associated with good graft outcome in kidney transplantation. PMID: 25582053
  23. C5AR1 SNP -1330T/G may serve as a useful pharmacodynamic predictor of nonsedating H1-antihistamine efficacy in chronic spontaneous urticaria (CSU), and -1330T alleles may be taken as a risk factor for CSU. PMID: 25455139
  24. Porphyromonas gingivalis induces C5aR-TLR2 coassociation in neutrophils. PMID: 24922578
  25. inhibition of TAFIa activity, however, was substrate-specific, because neither mAb inhibited the cleavage of thrombin-activated osteopontin and C5a by TAFIa, thus sparing the anti-inflammatory activity of TAFIa PMID: 24134522
  26. C5aR and C5L2 may have roles in adiposity in women PMID: 24523571
  27. The uPAR-C5aR axis, via the underlying NFkappaB transcriptional program, controls osteogenic differentiation with functional impact on vascular calcification in vivo. PMID: 24192237
  28. High levels of CD88 are associated with poor prognosis of NSCLC. PMID: 23706417
  29. C5aR cleavage is induced by neutrophil serine protease. The consequent impairment of C5aR activity contributes to suboptimal local neutrophil priming and bacterial clearance. PMID: 24446515
  30. complement can regulate Muller cells through C5aR, which may contribute to the pathogenesis of retinal diseases, including DR. PMID: 24265019
  31. C5aR is a regulatory switch that modulates TLR4 signaling via the Galphai/c-Raf/MEK/ERK signaling axis in human macrophages but not monocytes. PMID: 24043889
  32. The C5aR binding Panton-Valentine Leukocidin component, LukS-PV, is a potent inhibitor of C5a-induced immune cell activation. PMID: 23684309
  33. Data indicate that C5aR was aberrantly expressed in various cancers. PMID: 23287562
  34. CD88 receptor expression is increased in brain from Alzheimer's disease patients compared to controls or vascular dementia patients. PMID: 23394121
  35. C5aR-C5L2 homodimerization versus heterodimerization contribute to differential responses obtained following ASP vs C5a stimulation. PMID: 23268185
  36. An RP S19 oligomer inhibitor and a C5aR inhibitor blocked the association of the K562 basophilic EB-like cells. PMID: 23346183
  37. C5aR is shed during sepsis, resulting in the appearance of a previously undetected circulating C5aR in the serum of patients that negatively correlates with survival. PMID: 23479227
  38. the neutrophil C5aR acts as a dual pro-inflammatory and pro-apoptosis receptor during the initiation and the resolution phases of acute inflammation, respectively--{review} PMID: 23402022
  39. C5a receptor-dependent cell activation by physiological concentrations of desarginated C5a PMID: 23041570
  40. C5aR was expressed in the thick ascending limb of Henle's loop and first part of the distal convoluted tubule. Under inflammatory conditions, C5aR was de novo expressed in proximal tubuli. PMID: 22960554
  41. Complement C5a upregulates prolabor mediators in human gestational tissues via CD88-mediated NFKB activation. PMID: 22441801
  42. Analysis of the 3'UTR of the C5aR mRNA showed that it contained two AU-rich elements (AREs), however site directed mutagenesis showed that these had no effect on basal expression. PMID: 22608366
  43. The aim of this study was to investigate the genetic alterations and mRNA expression pattern of C5aR and C5L2 genes in neutrophils from attack-free familial Mediterranean fever patients. PMID: 22187344
  44. the monocyte C5aR selectively activates the classical pathway with the binding of C5a and the alternative pathway with the binding of C5a/RP S19. PMID: 21613290
  45. C5a, a complement activation product, is a useful marker in predicting the severity of necrotizing enterocolitis. PMID: 21628869
  46. Among a cohort of 60 critically ill patients, C5a-mediated neutrophil dysfunction (as determined by reduced CD88 expression) was a strong predictor for subsequent acquisition of nosocomial infection PMID: 21292772
  47. Data show that when a Gi/PI3K pathway is partially blocked, C5a receptors stimulate an alternative p38MAPK pathway. PMID: 20473571
  48. expression profiles of CRegs and CD88 on leukocytes are specifically altered after polytrauma in humans, indicating a trauma-induced "complementopathy PMID: 19864971
  49. The elevated local and systemic C5a levels, and additional individual local C5a increase during the exacerbation support the importance of C5a in Chronic Obstructive Pulmonary Disease. PMID: 20500690
  50. Data show that C5L2 is predominantly intracellular, while C5aR is expressed on the plasma membrane, and that internalized C5aR following ligand binding is co-localized with both C5L2 and beta-arrestin. PMID: 20044484

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle.
Protein Families
G-protein coupled receptor 1 family
Database Links

HGNC: 1338

OMIM: 113995

KEGG: hsa:728

STRING: 9606.ENSP00000347197

UniGene: Hs.2161

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*