Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 6(CEACAM6)

Code CSB-EP005166HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P40199
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Non-specific crossreacting antigen;Normal cross-reacting antigen;CD_antigen: CD66c
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG
Research Area Tags & Cell Markers
Source E.coli
Gene Names CEACAM6
Protein Names Recommended name: Carcinoembryonic antigen-related cell adhesion molecule 6 Alternative name(s): Non-specific crossreacting antigen Normal cross-reacting antigen CD_antigen= CD66c
Expression Region 35-320aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 47.2kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Lipid-anchor, GPI-anchor
Protein Families Immunoglobulin superfamily, CEA family
Database Links

HGNC: 1818

OMIM: 163980

KEGG: hsa:4680

STRING: 9606.ENSP00000199764

UniGene: Hs.466814

Related Products

CEACAM6 Antibodies

CEACAM6 Antibodies for Homo sapiens (Human)

CEACAM6 Antibodies for Human

CEACAM6 Proteins

CEACAM6 Proteins for Homo sapiens (Human)

CEACAM6 ELISA Kit

CEACAM6 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.