Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 6(CEACAM6)

Code CSB-EP005166HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names CEACAM6
Uniprot No. P40199
Research Area Tags & Cell Markers
Alternative Names Carcinoembryonic antigen related cell adhesion molecule 6 ; Carcinoembryonic antigen related cell adhesion molecule 6 (non specific cross reacting antigen); Carcinoembryonic antigen-related cell adhesion molecule 6; CD 66c; CD66c; CD66c antigen; CEA LIKE PROTEIN; CEACAM 6; CEACAM6; CEAL; CEAM6_HUMAN; MGC93832; NCA; Non specific cross reacting antigen; Non-specific crossreacting antigen; Normal cross reacting antigen; Normal cross-reacting antigen
Species Homo sapiens (Human)
Source E.coli
Expression Region 35-320aa
Target Protein Sequence KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 47.2kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Gene References into Functions
  1. CEACAM6 promoted oral squamous cell carcinoma cell invasion, migration, cytoskeletal rearrangement, and metastasis via interaction with EGFR and enhancing it activation. PMID: 28892050
  2. Studies provide evidence that dysregulated overexpression of CEACAM6 plays a role in several of the hallmarks of cancer, including uncontrolled proliferation, anoikis resistance, immune evasion, invasion and metastasis. [review] PMID: 29110374
  3. Helicobacter pylori HopQ binds the amino-terminal IgV-like domain of human CEACAM1, CEACAM3, CEACAM5 or CEACAM6 proteins, thereby enabling translocation of the major pathogenicity factor CagA into host cells. PMID: 27748756
  4. Here, the authors identify members of the carcinoembryonic antigen-related cell adhesion molecule (CEACAM) family as receptors of Helicobacter pylori and show that HopQ is the surface-exposed adhesin that specifically binds human CEACAM1, CEACAM3, CEACAM5 and CEACAM6. PMID: 27748768
  5. CD66c (KOR-SA3544) antigen expression of leukemic blasts in pediatric acute myeloid leukemia with TLS/FUS-ERG fusion transcript PMID: 28766906
  6. Data suggest that the expression of these TSPAN8, LGALS4, COL1A2 and CEACAM6 in the whole blood may be useful in the detection of colorectal cancer (CRC). PMID: 26993598
  7. expression is increased in severe asthma and primarily associated with airway epithelial cells and tissue neutrophils PMID: 28275137
  8. a 7-gene signature was identified which correctly predicted the primary prefibrotic myelofibrosis group with a sensitivity of 100% and a specificity of 89%. The 7 genes included MPO, CEACAM8, CRISP3, MS4A3, CEACAM6, HEMGN, and MMP8 PMID: 27579896
  9. In enterocytic C2BBe1 cells, Candida albicans caused a transient tyrosine phosphorylation of CEACAM1 and induced higher expression of membrane-bound CEACAM1 and soluble CEACAM6. PMID: 28292985
  10. Monoclonal Antibody 1B5A5 Against CEACAM6 PMID: 27328063
  11. western blot analysis results indicated that the 1B5A5 epitope is located within an amino-terminal domain of CEACAM6. These results raised the possibility that our approach could lead to discovery of novel biomarkers for the early stage of cancers in a relatively short period of time. PMID: 27172290
  12. show the upregulation of the tumor-associated antigens CEACAM5/6 by trans-signaling of the pro-inflammatory cytokine IL-6 PMID: 26673628
  13. Biliary CEACAM6 can identify patients with extrahepatic cholangiocarcinoma with a high degree of sensitivity and should be investigated further as a potential screening tool. PMID: 26974538
  14. Data suggest ways in which carcinoembryonic antigen-related cell adhesion molecules CEACAM6 and CEACAM8 regulate the biological functions of one another. PMID: 26483485
  15. CEACAM6 protein and mRNA were increased ~4-fold in lungs from infants with chronic lung disease as compared with controls. PMID: 26374831
  16. vaccination with recombinant attenuated Salmonella harboring the CEACAM6 and 4-1BBL gene efficiently increased the number of CD3+CD8+ TIL and NK cells, decreased the number of FOXP3 cells and inhibited the development of DMH-induced colorectal cancer PMID: 25872647
  17. CEACAM6 increased the levels of phosphorylated AKT, which is involved in the progression of a variety of human tumors. PMID: 25398131
  18. Data show that carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6) and forkhead box P3 (FOXP3) are associated with the malignant degree of pancreatic cancer. PMID: 26271985
  19. Data indicate that carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6) promotes angiogenesis in gastric cancer via focal adhesion kinase FAK signaling. PMID: 25703140
  20. Results show that pancreatic cancer patients with CEACAM 1, 5 and 6 expression showed a significantly shortened overall survival and elevated serum values are correlated with distant metastasis suggesting a role in epithelial-mesenchymal transition. PMID: 25409014
  21. CEACAM6 may be a valuable biomarker screening for gastric tumor and novel predictor for patients in advanced stages of gastric cancer PMID: 25299082
  22. results suggested that CEACAM6 functions as an oncoprotein in gastric cancer and may be an important metastatic biomarker and therapeutic target PMID: 24492534
  23. CEACAM6 expression was expressed in different molecular subtypes of breast cancer. Among different subtypes, the highest expression was found with HER2 positive cancers. PMID: 24186057
  24. High carcinoembryonic cell adhesion molecule 6 expression is associated with malignant biliary stenoses. PMID: 23806607
  25. our findings identified CEACAM6, which is regulated by miR-29a/b/c, as an important positive regulator of EMT in pancreatic cancer PMID: 23857344
  26. CD66c expression appears useful only as a predictor of the Ph in adult patients (not in pediatric cases). PMID: 24014076
  27. Data indicate that CD66c is frequently expressed in CRLF2-positive as well as hypodiploid cases. PMID: 24231528
  28. these findings show that PDEF-CEACAM6 is a highly active oncogenic axis in breast cancer PMID: 23592399
  29. CEACAM-6 plays an important role in the regulation of CD8+ T-cell responses against multiple myeloma. PMID: 23603913
  30. CEACAM6 is significantly upregulated in colon cancer tissues and is closely associated with poor prognosis. PMID: 22975528
  31. The expression of CD66c was significantly higher in colorectal cancer specimens than in normal colon. PMID: 23027178
  32. CEACAM6 is focally overexpressed in a large fraction of human HNSCCs in situ. over-expression of CEACAM6 increases tumour growth and tumour initiating activity by suppressing PI3K/AKT-dependent apoptosis of HNSCC in a xenotransplant model of HNSCC. PMID: 23021083
  33. High CEACAM6 expresssion is associated with inflammatory bowel disease. PMID: 21994005
  34. a novel role for NA in enhancing host cell survival by activating the Src/Akt signaling axis via an interaction with carcinoembryonic antigen-related cell adhesion molecule 6/cluster of differentiation 66c (C6). PMID: 22396546
  35. The authors show that the expression of CEACAM1 and CEACAM6 potentiate CEACAM3-dependent responses of neutrophils, exposing a cooperative role for this family of proteins during neisserial infection of neutrophils. PMID: 22064717
  36. CEACAM6 is expressed by alveolar and airway epithelial cells of human lung and is secreted into lung-lining fluid, where fully glycosylated protein binds to surfactant. PMID: 22037359
  37. Despite its important role in bacterial attachment in ileal CD, no role was detected for CEACAM6 variants in IBD susceptibility or regarding an ileal CD phenotype PMID: 21559399
  38. The highly elevated gene expression of CEACAM6 and CEACAM8 in primary myelofibrosis can serve as molecular markers of myelofibrotic transformation. PMID: 21470677
  39. High serum CEACAM6 is associated with gastric cancer. PMID: 21618249
  40. CEACAM6 and a regulatory element near the 3' end of CEACAM3 are associated with cystic fibrosis disease severity and intrapair discordance PMID: 20047061
  41. Positivity for both leukemia-associated antigens CD66c and CD25 in combination can predict the presence of BCR/ABL rearrangement in pre-B cell acute lymphoblastic leukemia PMID: 20063526
  42. Overexpression of CEACAM6 disrupts tissue architecture and blocks colonocyte differentiation PMID: 11896570
  43. CEACAM6 subdomains involved in intercellular adhesion activity and subdomains involved in inhibition of cell differentation are identified and their respective activities are independently blocked. PMID: 12571231
  44. CEACAM6 gene silencing reversed the acquired anoikis resistance of tumor cell lines and inhibited in vivo metastatic ability PMID: 14724575
  45. overexpression among human malignancies, immunological targeting of this tumor antigen may have therapeutic applicability PMID: 15081416
  46. the results show that recognition of CEA and CEACAM6, but not CEACAM1, is accompanied by tight attachment to bacteria of cell surface microvilli-like extensions PMID: 15130118
  47. CEACAM6 is an important determinant of pancreatic adenocarcinoma malignant cellular behavior PMID: 15208677
  48. Levels of CEACAM6 expression can modulate pancreatic adenocarcinoma cellular invasiveness in a c-Src-dependent manner PMID: 15316565
  49. CD66c is regulated in a manner distinct from other myeloid antigens in childhood lymphoblastic leukemia PMID: 15826304
  50. Data show that variants of Neisseria gonorrhoeae that bind to human carcinoembryonic antigen-related cell adhesion molecules (CEACAMs) 1 and 6 failed to induce detachment and, instead, promoted enhanced host cell adhesion to the ECM. PMID: 16115956
  51. The expression of CEACAM6 in ADH lesions is strongly associated with the development of IBC, therefore, it can be applied as a diagnostic marker either singly or in combination with other marker(s) to predict IBC development in women with ADH lesions. PMID: 16899629
  52. CEA and CEACAM6 was shown to lead to an increase in the binding of the integrin alpha5beta1 receptor to its ligand fibronectin, without changing its cell surface levels, resulting in increased adhesion of CEA/CEACAM6-expressing cells to fibronectin. PMID: 17167768
  53. For all tumors, the amount of CEACAM6 expressed was greater than that of CEACAM5, and reflected tumor histotype. PMID: 17201906
  54. CEA-mediated signaling involves clustering of CEA and co-clustering and activation of the alpha5beta1 and associated specific signaling elements on the internal surfaces of membrane microdomains PMID: 17286276
  55. CEACAM6 is a biological tumor marker for epithelial ovarian cancers. PMID: 17503391
  56. CEACAM6 acts as a receptor for adherent-invasive E. coli adhesion and is abnormally expressed by ileal epithelial cells in Crohn disease. PMID: 17525800
  57. findings suggest that CEA (CEACAM5) and CEACAM6 are major target genes for Smad3-mediated TGF-beta signaling. PMID: 17653079
  58. All the leukemic samples showed overexpression of CEACAM6 and 8 when compared with normal granulocytes. PMID: 17909799
  59. data support an important role for CEACAM6 in endocrine resistance in breast cancer, which can serve as a powerful predictor of future recurrence PMID: 18223215
  60. CEACAM6 is overexpressed in borderline and invasive mucinous ovarian neoplasms. PMID: 18331757
  61. Data show that desensitization of neutrophils to any two CEACAMs, 1, 3, 6, or 8, results in selective desensitization to those two CEACAMs, while the cells remain responsive to the other two neutrophil CEACAMs. PMID: 19077207
  62. Because CEACAM6 acts as an antiapoptotic factor and stabilizes surfactant function, in addition to a putative role in innate defense against bacteria, we propose that it is a multifunctional alveolar protein PMID: 19329538
  63. CEACAM6-associated signaling pathways could be potential targets for the development of biomarkers to predict the response of patients to adenovirus-based therapies, as well as for the development of more potent adenovirus-based therapeutics PMID: 19411761
  64. the first study to demonstrate the prognostic relevance of CEACAM6 overexpression in human colorectal cancer PMID: 14512395

Show More

Hide All

Subcellular Location Cell membrane, Lipid-anchor, GPI-anchor
Protein Families Immunoglobulin superfamily, CEA family
Database Links

HGNC: 1818

OMIM: 163980

KEGG: hsa:4680

STRING: 9606.ENSP00000199764

UniGene: Hs.466814

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1