Recombinant Human Cathepsin L2 (CTSV)

Code CSB-MP006194HUc7
Abbreviation Recombinant Human CTSV protein
MSDS
Size $268
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Cathepsin U;Cathepsin V
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
18-334aa
Target Protein Sequence
VPKFDQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELHNGEYSQGKHGFTMAMNAFGDMTNEEFRQMMGCFRNQKFRKGKVFREPLFLDLPKSVDWRKKGYVTPVKNQKQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cysteine protease. May have an important role in corneal physiology.
Gene References into Functions
  1. CTSV is involved in melanosome degradation. PMID: 29654760
  2. exogenous CTSV inhibited Ang -induced hypertrophy in HCM cells by inhibiting PI3K/Akt/mTOR PMID: 28522343
  3. Cathepsins V and S may serve as auxiliary diagnostic and/or prognostic markers in thymic epithelial tumors. PMID: 27771373
  4. E2F1 directly binds to CTSL2 promoter and regulates CTSL2 gene expression. PMID: 23542171
  5. using cathepsin V and cathepsin L as model enzymes, a series of chimeras were generated to identify noncatalytic regions that are responsible for the potent elastolytic activity of cathepsin V PMID: 24121514
  6. Cathepsin V expression contributes to the development of dermal fibrosis and vasculopathy in systemic sclerosis. PMID: 23287360
  7. functions of cathepsin V are controlled by N-glycosylation PMID: 22967898
  8. Findings indicate the unique function of cathepsin V for producing enkephalin and neuropeptide Y (NPY) neuropeptides required for neurotransmission in health and neurological diseases. PMID: 22393040
  9. CTSL2 might be involved in progression of endometrial cancer. PMID: 22452389
  10. A proteolytically active variant of cathepsin V is localized to cell nucleus (in peri-nucleolar pattern) in thyroid carcinoma cells. PMID: 20536394
  11. stratum corneum thiol protease is identical with the recently described cathepsin L2 protease. PMID: 12648222
  12. Cathepsin V is involved in the degradation of invariant chain in human thymus PMID: 12925692
  13. Cathepsin V has an elastolytic activity and is expressed in activated macrophages PMID: 15192101
  14. Human cathepsin V compensates for murine cathepsin L in mouse epidermis and hair follicles. PMID: 15679121
  15. propeptide was found to behave as a tight-binding inhibitor against CatV PMID: 17516850
  16. Associated with type 1 diabetes and early-onset myasthenia gravis. PMID: 17869649
  17. angiogenesis inhibition activity on endothelial cells caused by plasminogen processing by cathepsin V PMID: 18163891

Show More

Hide All

Subcellular Location
Lysosome.
Protein Families
Peptidase C1 family
Tissue Specificity
Predominantly expressed in the thymus and testis. Also expressed in corneal epithelium, and to a lesser extent in conjunctival epithelium and skin.
Database Links

HGNC: 2538

OMIM: 603308

KEGG: hsa:1515

STRING: 9606.ENSP00000259470

UniGene: Hs.610096

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*