Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

C4B

Uniprot No.

P0C0L5

Alternative Names

Basic complement C4; C2B5; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 3; C4b; C4B1; C4B2; C4B3; CO4B_HUMAN; Complement C4 gamma chain; Complement component 4B; CPAMD3

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1454-1744aa

Target Protein Sequence

EAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

49.1kDa

Protein Length

partial

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The expression region of this recombinant Human C4B covers amino acids 1454-1744. This C4B protein is theoretically predicted to have a molecular weight of 49.1 kDa. This C4B recombinant protein is manufactured in e.coli. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of C4B, which enables a simple process of detecting and purifying the C4B recombinant protein in the following steps.

Complement C4-B (C4B) is a component of the complement system, a crucial part of the immune system involved in recognizing and eliminating pathogens. C4B is one of the isoforms of the C4 protein, which is encoded by the C4B gene located in the major histocompatibility complex (MHC) on chromosome 6. The complement system is activated through a cascade of proteolytic reactions, leading to the formation of C4b, which participates in immune responses, including opsonization, inflammation, and cell lysis. C4B, in conjunction with other complement components, contributes to the clearance of immune complexes and pathogens. Polymorphisms in the C4B gene have been associated with various autoimmune diseases, emphasizing the importance of C4B in immune regulation and homeostasis. Understanding the function and genetic variations of C4B is crucial for unraveling the complexities of immune responses and their implications for health and disease.

Target Background

Function

Non-enzymatic component of the C3 and C5 convertases and thus essential for the propagation of the classical complement pathway. Covalently binds to immunoglobulins and immune complexes and enhances the solubilization of immune aggregates and the clearance of IC through CR1 on erythrocytes. C4A isotype is responsible for effective binding to form amide bonds with immune aggregates or protein antigens, while C4B isotype catalyzes the transacylation of the thioester carbonyl group to form ester bonds with carbohydrate antigens.; Derived from proteolytic degradation of complement C4, C4a anaphylatoxin is a mediator of local inflammatory process. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes.

Involvement in disease

Systemic lupus erythematosus (SLE); Complement component 4B deficiency (C4BD)

Subcellular Location

Secreted. Cell junction, synapse. Cell projection, axon. Cell projection, dendrite.

Tissue Specificity

Complement component C4 is expressed at highest levels in the liver, at moderate levels in the adrenal cortex, adrenal medulla, thyroid gland, and the kidney, and at lowest levels in the heart, ovary, small intestine, thymus, pancreas and spleen. The extr

Database Links

HGNC: 1324

OMIM: 120820

KEGG: hsa:100293534

STRING: 9606.ENSP00000415941

UniGene: Hs.534847

Code	CSB-EP313364HU
Abbreviation	Recombinant Human C4B protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Complement C4-B (C4B), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage