Recombinant Human Cytokine receptor-like factor 2 (CRLF2), partial (Active)

In Stock Promotion
Code CSB-MP005983HU
Abbreviation Recombinant Human CRLF2 protein, partial (Active)
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA.Immobilized Human CRLF2 at 2 μg/ml can bind Anti-CRLF2 recombinant antibody(CSB-RA005983MA1HU). The EC50 is 1.630-1.842 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Human CRLF2 at 2 μg/mL can bind Anti-CRLF2 recombinant antibody(CSB-RA005983MA1HU). The EC50 is 1.630-1.842 ng/mL.
Target Names
Uniprot No.
Alternative Names
Cytokine receptor-like factor 2; Cytokine receptor-like 2; IL-XR; Thymic stromal lymphopoietin protein receptor; TSLP receptor
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
25-231aa
Target Protein Sequence
GAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK
Mol. Weight
26.8 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

CRLF2 forms a heterodimeric receptor complex with IL-7Rα to mediate thymic stromal lymphopoietin (TSLP) signaling, a pathway implicated in allergic inflammation and certain B-cell acute lymphoblastic leukemias. This mammalian-expressed construct spanning residues 25–231 captures the extracellular ligand-binding domain and demonstrates quantifiable antibody-binding activity with an EC50 of 1.630–1.842 ng/mL in functional ELISA, providing a validated reagent for therapeutic antibody epitope mapping, competitive inhibition screening, and receptor-ligand interaction studies by ELISA or surface plasmon resonance. The low endotoxin level (< 1.0 EU/μg) and > 95% purity measured by SDS-PAGE align with standards expected in blocking antibody assays and affinity characterization experiments where contaminating proteins or pyrogens would confound binding kinetics. Mammalian expression supports native glycosylation and disulfide bond formation critical for conformational epitope presentation, making this protein appropriate for validating anti-CRLF2 biologics in immunology research focused on TSLP-driven immune responses.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for thymic stromal lymphopoietin (TSLP). Forms a functional complex with TSLP and IL7R which is capable of stimulating cell proliferation through activation of STAT3 and STAT5. Also activates JAK2. Implicated in the development of the hematopoietic system.
Gene References into Functions
  1. Family-based whole genome analysis of a family with hereditary pulmonary alveolar proteinosis revealed a homozygous deletion that disrupts CSF2RA, CRLF2, and IL3RA gene in the pseudoautosomal region of the X chromosome in the affected child and one of asymptomatic siblings. PMID: 28233860
  2. TSLP expression on the basophil membrane of patients with severe asthma was not significantly different from healthy controls. PMID: 29402810
  3. high CRLF2 expression works with the IKZF1 deletion to drive oncogenesis of acute lymphoblastic leukemia PMID: 27391346
  4. this study shows that CRLF2 over-expression is a poor prognostic marker in children with high risk T-cell acute lymphoblastic leukemia PMID: 27449287
  5. data suggest that this high frequency of genetic aberrations in the context of a high CRLF2 expression could contribute to the high risk of relapse in P2RY8/CRLF2- and IGH/CRLF2-positive acute lymphoblastic leukemia. PMID: 28371317
  6. CRLF2 overexpression is associated with childhood B-cell acute lymphoblastic leukemia. PMID: 27637012
  7. CRLF2 gene rearrangement is associated with acute lymphoblastic leukemia. PMID: 28033648
  8. TSLPR levels were found to be significantly higher in asthmatic than in nonasthmatic children. TSLPR expression in non-allergic asthmatic and allergic asthmatic groups was found to be significantly higher than in non-allergic nonasthmatic group PMID: 26999524
  9. In adult B-cell acute lymphoblastic leukemia without recurrent fusion genes , high CRLF2 expression is associated with distinct clinico-biological features and an unfavourable prognosis PMID: 26754556
  10. CD4+ T cells from atopic dermatitis patients directly interacted with TSLP to produce a higher amount of IL-4 than those from normal subjects, and this action was attenuated with anti-TSLPR antibody PMID: 26288354
  11. The levels of mRNA for TSLP and TSLPR were significantly elevated in parotid gland tissues from the KD group as compared to the control group. PMID: 25676453
  12. Differences exist in the genetic profiles of Down syndrome-associated acute lymphoblastic leukemia patients in Japan and in Western countries, and that P2RY8-CRLF2 and EBF1 deletions may cooperate in leukemogenesis in a subset of Japanese DS-ALL patients. PMID: 25044358
  13. CRLF2 overexpression (OE) was detected in 30 (18%) of 167 patients, the P2RY8-CRLF2 fusion was identified in only 3 (1.8%) of 167 patients, all of which demonstrated CRLF2 OE. PMID: 24935070
  14. we report noncysteine in-frame mutations in IL7R and CRLF2 located in a region of the transmembrane domain closer to the cytosolic domain in acute lymphoblastic leukemias PMID: 24787007
  15. The TSLPR in blood plateltes promotes platelet activation via activating the PI3K/AKT pathway. PMID: 24356513
  16. both IKZF1 deletions and IGH@-CRLF2 are associated with an increased risk of treatment failure in adult acute lymphoblastic leukemia PMID: 24018820
  17. Data indicate that CD66c is frequently expressed in CRLF2-positive as well as hypodiploid cases. PMID: 24231528
  18. Higher cumulative incidence of relapse was found for BCR-ABL1-like and IKZF1-deleted, but not CRLF2-high, cases relative to remaining BCP-ALL cases. PMID: 23974192
  19. IKZF1 deletions and CRLF2-high expression predicted poor outcomes in patients with HR-ALL but not in patients with SR-ALL in our Japanese cohort PMID: 23804397
  20. Results show no clinical or laboratory difference between those with high and low crlf2 expression PMID: 23145900
  21. P2RY8-CRLF2-positive clones do not have the necessary proliferative or selective advantage to evolve into a disease-relevant relapse clone. PMID: 23091296
  22. Neither CRLF2 nor JAK2 were predictors for worse prognosis in children with Down's syndrome and acute lymphoblastic leukemia. PMID: 22441210
  23. Poor prognosis for P2RY8-CRLF2 fusion but not for CRLF2 over-expression in children with intermediate risk B-cell precursor acute lymphoblastic leukemia. PMID: 22484421
  24. CRLF2-overexpressing B-cell acute lymphoblastic leukemias have a gain-of-function CRLF2 F232C mutation or activating mutations in JAK2. PMID: 22915648
  25. CRLF2-deregulation and IGH locus translocations represent distinct subtypes of adolescent and adult acute lymphoblastic leukemia. PMID: 22851563
  26. This review sums up diverse mechanisms that mediate TSLP/TSLP receptor-signalling network in chronic airway diseases. PMID: 22168549
  27. CRLF2 overexpression is associated with acute lymphoblastic leukemia. PMID: 22297722
  28. High CRLF2 expression is associated with a very poor outcome in high-risk, but not standard-risk, acute lymphoblastic leukemia. PMID: 22368272
  29. Data indicate that overexpression of CRLF2 was not observed in adult patients with Ph-positive or T-ALL but was limited to B-ALL patients with a normal diagnostic karyotype. PMID: 21457190
  30. review highlights the current knowledge of the incidence, prognostic significance, and biology of CRLF2-overexpressing ALL and future directions for development of targeted therapies PMID: 22150304
  31. TSLPR expression was significantly higher in the inflammatory infiltrate and in the epithelial cells of chronic rhinosinusitis with or without nasal polyps PMID: 21978707
  32. Integrated genomic profiling has identified potential therapeutic targets in acute lymphoblastic leukemia, including aberrant cytokine receptor signaling mediated by rearrangements and mutation of CRLF2 PMID: 21169835
  33. Deregulated expression of CRLF2 (CRLF2-d) arises via its juxtaposition to the IGH@ enhancer or P2RY8 promoter. Among 865 BCP-ALL children treated on MRC ALL97, 52 (6%) had CRLF2-d, but it was more prevalent among Down syndrome patients (54%). PMID: 21106984
  34. increased CRLF2 expression associates with JAK2 mutation, a combination that transforms hematopoietic cells, suggesting that mutant JAK2 and CRLF2 may cooperate to contribute to B-progenitor acute lymphoblastic leukemia formation [review] PMID: 20807819
  35. The genotype and allele frequencies of the g.33G>C and g.19646A>G of the TSLPR gene were significantly associated in the atopic asthma patients rather than in the non-atopic asthma patients PMID: 20663412
  36. Studies indicate that of 19 total CRLF2 breakpoints, 7 are directly at CpGs and breakpoints are much closer to CpGs than expected by random chance. PMID: 20847213
  37. Study reports an extremely high incidence of relapse (71% +/- 19%) in non-high-risk precursor B-cell acute lymphoblastic leukemia patients with P2RY8-CRLF2 rearrangement. PMID: 20378752
  38. Activation of CRLF2 expression, mutation of of JAK1 or JAK2, and alterations of IKZF1 cooperate to promote B-cell leukemogenesis. PMID: 20139093
  39. The hymic stromal lymphopoietin receptor is involved in the pathogenesis of allergic asthma through the activation of human airway smooth muscle cells by t hymic stromal lymphopoietin PMID: 20483734
  40. human TSLP receptor requires the function of JAK1 and JAK2 for STAT activation PMID: 20128689
  41. Activating mutation in the TSLPR gene in B-cell precursor lymphoblastic leukemia; results indicate that TSLPR activation may occur independently of a JAK2R683 mutation and that TSLPR can also be the site of a point mutation PMID: 19907440
  42. Our data indicate that epithelial cells express TSLPR and that TSLP induces bronchial epithelial cell proliferation and increases injury repair through IL-13 production. PMID: 20236697
  43. Induced homodimerization of receptor chimeras containing the transmembrane and cytoplasmic domains of both human and mouse TSLP receptors is not sufficient for driving cell proliferation. PMID: 20096461
  44. Results implicate CRLF2 as an important factor in precursor B-cell acute lymphoblastic leukemia with diagnostic, prognostic, and therapeutic implications. PMID: 20018760
  45. Results suggest that the majority of DS children with ALL may benefit from therapy blocking the CRLF2/JAK2 pathways. PMID: 19965641
  46. Expression of TSLP receptor was upregulated on atopic DCs primed with H22-Fel d 1 through a pathway regulated by FcgammaRI-associated signaling components. PMID: 20109752
  47. The presence of TSLP receptors is unexpectedly demonstrated on activated human CD4-positive T cells. PMID: 17513717
  48. A causal role of CRLF2 overexpression in lymphoid transformation. PMID: 19641190
  49. report a recurring interstitial deletion of the pseudoautosomal region 1 of chromosomes X and Y in B-progenitor acute lymphoblastic leukemia that juxtaposes the first, noncoding exon of P2RY8 with the coding region of CRLF2. PMID: 19838194

Show More

Hide All

Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.
Protein Families
Type I cytokine receptor family, Type 5 subfamily
Tissue Specificity
Expressed in heart, skeletal muscle, kidney and adult and fetal liver. Primarily expressed in dendrites and monocytes. Weakly expressed in T-cells.
Database Links

HGNC: 14281

OMIM: 300357

KEGG: hsa:64109

STRING: 9606.ENSP00000370979

UniGene: Hs.287729

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*