Recombinant Human DNA-binding protein inhibitor ID-1(ID1)

Code CSB-EP010966HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names ID1
Uniprot No. P41134
Research Area Cancer
Alternative Names bHLHb24; Class B basic helix-loop-helix protein 24; dJ857M17.1.2 (inhibitor of DNA binding 1, dominant negative helix-loop-helix protein); DNA binding protein inhibitor ID 1; DNA binding protein inhibitor ID1; DNA-binding protein inhibitor ID-1; Dominant negative helix loop helix protein; ID 1; ID; ID1; ID1_HUMAN; Inhibitor of Differentiation 1; Inhibitor of DNA binding 1; inhibitor of DNA binding 1, dominant negative helix-loop-helix protein
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-155aa
Target Protein Sequence MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 32.1kDa
Protein Length Full Length
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer (By similarity).
Gene References into Functions
  1. Low ID1 expression is associated with breast cancer. PMID: 30066902
  2. ID1, CTCF and ELK1 may be associated with prostate cancer, and may be potential therapeutic targets for the treatment of this disease. PMID: 29956775
  3. CaMKII can directly phosphorylate Beclin 1 at Ser90 to promote K63-linked ubiquitination of Beclin 1 and activation of autophagy; it also promotes K63-linked ubiquitination of inhibitor of differentiation 1/2 (Id-1/2) by catalyzing phosphorylation of Id proteins and recruiting TRAF-6 PMID: 29079782
  4. ID1 expression was associated with the proliferation, invasion and migration of SACC cells. The observed inhibition of SACC cell growth, invasion and migration following knockdown of ID1 expression in the present study, may have been due to restoration of the balance between oncogenic and tumor-suppressive effects resulting from changes in the expression of downstream genes or associated proteins. PMID: 29039489
  5. The mutual correlation between the expression level of TWIST1 and ID1 might be a critical factor driving the process of the human odontoblasts' differentiation. PMID: 29159326
  6. a loss of CULLIN3 represents a common signaling node for controlling the activity of intracellular WNT and SHH signaling pathways mediated by ID1 PMID: 27477274
  7. Id1 enables lung cancer liver colonization by activating an epithelial mesenchymal transformation program in tumor cells and establishing the pre-metastatic niche. PMID: 28549790
  8. High ID1 expression is associated with breast cancer. PMID: 27546618
  9. ID1 expression impacts the sensitivity of colon cancer cells to 5-FU and may be considered as a potential predictive marker in colorectal carcinoma treatment. PMID: 28510612
  10. Reducing ID1 gene expression reduces metastatic spread of salivary gland neoplasms. PMID: 27087608
  11. High ID-1 expression is associated with colorectal carcinoma. PMID: 27633352
  12. ID1 expression was positively related to drug resistance of EGFR-TKI in non-small cell lung cancer. PMID: 27978873
  13. MVD was determined by immunohistochemistry, and the expressions of mRNA and protein of inhibitor of differentiation-1 (ID1) and vascular endothelial growth factor (VEGF) were detected in gastric cancer. PMID: 27610466
  14. ID1 down-regulation induced parallel changes in the IGF and AKT pathways. The crosstalk of these pathways may enhance malignant phenotypes in salivary gland cancer. PMID: 27466488
  15. Results show that ID1, ID3 and IGJ genes are highly expressed in adult B-ALL and correlate with poor prognosis in Hispanic patients. PMID: 27044543
  16. Our findings define an intricate E2F1-dependent mechanism by which Id1 increases thymidylate synthase and IGF2 expressions to promote cancer chemoresistance. The Id1-E2F1-IGF2 regulatory axis has important implications for cancer prognosis and treatment. PMID: 26475334
  17. Peritoneal VEGF-A expression is regulated by TGF-beta1 through an ID1 pathway in women with endometriosis PMID: 26577912
  18. Id-1, a protein repressed by miR-29b, facilitates TGFbeta1-induced EMT in human ovarian cancer cells and represents a promising therapeutic target for treating ovarian cancer. PMID: 24662327
  19. Simultaneous high expression of ID1 and c-Jun or c-Fos was correlated with poor survival in esophageal squamous cell carcinoma patients. PMID: 26858249
  20. Id1 as an important modulator of molecular events during DPSC commitment and differentiation, which should be considered in dental research on tissue engineering. PMID: 24695670
  21. Therefore, we identified a tumorigenic role of Id-1 in OS and suggested a potential therapeutic target for OS patients. PMID: 26797271
  22. these findings provide in vivo genetic evidence of Id1 functions as an oncogene in breast cancer PMID: 25938540
  23. ID1 overexpression may be associated with higher risk karyotype classification and act as an independent risk factor in young non-M3 acute myeloid leukemia patients. PMID: 26191235
  24. Advanced melanoma patients, relative to healthy controls, express much higher levels of ID1 in myeloid peripheral blood cells. PMID: 25924227
  25. LIF has a role in negatively regulating tumour-suppressor p53 through Stat3/ID1/MDM2 in colorectal cancers PMID: 25323535
  26. Overexpression of ID1 is associated with colorectal neoplasia. PMID: 25623217
  27. Inhibitor of differentiation 4 (ID4) acts as an inhibitor of ID-1, -2 and -3 and promotes basic helix loop helix (bHLH) E47 DNA binding and transcriptional activity. PMID: 25778840
  28. Four more genes (BMP4, BMPR1B, SMAD1 and SMAD4) of the ID1 pathway were investigated and only one (BMPR1B) shows the same down regulation PMID: 26072160
  29. Smad1 as a novel binding protein of KSHV latency-associated nuclear antigen (LANA). LANA interacted with and sustained BMP-activated p-Smad1 in the nucleus and enhanced its loading on the Id promoters. PMID: 25010525
  30. berberine's anti-proliferative and anti-invasive activities could be partially rescued by Id-1 overexpression in HCC models, revealing a novel anti-cancer/anti-invasive mechanism of berberine via Id-1 suppression. PMID: 25496992
  31. NSCLC cells with high Id1 protein expression were vulnerable to the treatment of paclitaxel and cisplatin PMID: 25344919
  32. We conclude that Id1 is potently angiogenic and can be up-regulated in endothelial progenitor cells PMID: 24620998
  33. Id-1 and TGF-beta1 played important roles in the progression of gastric cancer, in which Id-1 might act as a downstream mediator of TGF-beta1 signaling through a regulatory mechanism involving N-cadherin and beta-catenin. PMID: 24861919
  34. Downregulation of ID1 by gene silencing can lead to acceleration of TGF-beta1-induced hESC differentiation into ECs and inhibition of proliferation and migration of ECs. PMID: 25549282
  35. Overexpression of ID1 in two different cell lines induced STMN3 and GSPT1 at the transcriptional level, while depletion of ID1 reduced their expression. PMID: 25028095
  36. Our results suggest that Id1 promotes breast cancer metastasis by the suppression of S100A9 expression PMID: 24948111
  37. This study elucidated the potential mechanism underlying Id1 participation in the progression of prostate cancer PMID: 25031707
  38. Data indicate that grap2 and cyclin D1 interacting protein (GCIP) and inhibitor of of DNA binding/differentiation 1 (Id1) are inversely expressed in non-small cell lung cancer (NSCLC) cell lines and specimens. PMID: 24970809
  39. ERbeta1 inhibits the migration and invasion of breast cancer cells and upregulated E-cadherin expression in a Id1-dependent manner. PMID: 25514034
  40. High Id1b, generated by alternative splicing, maintains cell quiescence and confers self-renewal and cancer stem cell-like properties. PMID: 25449776
  41. Data indicate that the inhibitor of DNA binding 1 (Id1)-IGF-II-IGF-IR-AKT signaling cascade plays an important role in esophageal cancer progression. PMID: 24599933
  42. ID1 expression in pancreatic adenocarcinoma was associated with angiogenesis as measured by microvessel density. PMID: 24480377
  43. Studies demostrated the regulatory role of ID1 in the proliferation and metastasis of colorectal cancer. PMID: 24804700
  44. Results show that Id1 and NF-kappaB regulate the expression of CD133 and BMI-1 in an additive or synergistic manner in oral squamous cell carcinoma. PMID: 24572994
  45. Higher Id1 mRNA expression levels might predict a higher hazard ratio for progression and a shorter disease-free survival in prostate cancer. PMID: 24129125
  46. ID1 is a synthetic sick/lethal gene that interacts with the R175H TP53 mutant. PMID: 24378760
  47. These results indicate that Id1 may down-regulate the ability of PC3 cells to form osteolytic lesions in vivo and the signal pathway needs to be further investigated. PMID: 22684559
  48. Id1 induces mesenchymal-to-epithelial transition and pulmonary metastatic colonization by antagonizing Twist1 activity. PMID: 24332369
  49. The results demonstrate that Id-1B decreases the malignancy of lung and prostate cancer cells and counteracts the protumorigenic role of the classical form of Id-1. PMID: 24295493
  50. Inhibitor of differentiation 1 is a prognostic marker for multicentric Castleman's disease. PMID: 24599583
  51. Id-1 cooperates with HPV E6E7 proteins, which involves inactivation of p53 and pRb in host cells, to promote cervical carcinogenesis. PMID: 24628854
  52. Id-1 is considered to be a candidate for new therapeutic target and a prognostic factor in non-small cell lung cancer. PMID: 24133588
  53. Results suggest that inhibitor of differentiation or DNA binding -1 (Id-1) may play roles in tumor progression and epithelial-to-mesenchymal transition (EMT) activation in bladder cancer. PMID: 22226665
  54. Investigated the effect of Id1 on TGF-beta-induced collagen expression in dermal fibroblasts. When Id1-b isoform was overexpressed, TGF-beta-induced collagen expression was markedly inhibited. PMID: 24434151
  55. EGCG induces apoptosis and inhibits proliferation of poorly differentiated AGS gastric cancer cells, and Id1 may be one of the target genes regulated by EGCG in cancer inhibition. PMID: 23900621
  56. High ID-1 expression is associated with high microvessel density in ovarian cancer. PMID: 24403496
  57. inhibitor of differentiation-1 is expressed during fetal embryogenesis and in different mouse and human cancer types PMID: 23558671
  58. increased Id1 and Id3 expression attenuates all three cyclin-dependent kinase inhibitors (CDKN2B, -1A, and -1B) resulting in a more aggressive PCa phenotype. PMID: 23342268
  59. E47 interacts with Id1 in E47 overexpressing MDCK cells that underwent a full epithelial-mesenchymal transition as well as in mesenchymal breast carcinoma and melanoma cell lines PMID: 23555842
  60. Id1 can enhance EPC angiogenesis in ovarian cancer, which is mainly mediated by the PI3K/Akt and NF-kappaB/MMP-2 signaling pathways PMID: 23714001
  61. Ectopic expression of ID proteins partially rescues the senescence-like phenotype induced by loss of DPY30. PMID: 23872946
  62. This study revealed that there was a positive correlation between Id-1 expression and the expression of p-Akt, p-GSK3beta and p-HSF1 in oral squamous cell carcinoma. PMID: 23723304
  63. Id proteins, and particularly Id1 and Id3, are critical downstream effectors of BMP signaling in pulmonary artery smooth muscle cell. PMID: 23771884
  64. High expression level of ID1 gene was mostly seen in acute myeloid leukemia patients with adverse cytogenetics and older age (age >/= 60 years), and might be associated with poor prognosis. PMID: 22781717
  65. Id1 and Id3 co-expression seems associated with a poor clinical outcome in patients with locally advanced NSCLC treated with definitive chemoradiotherapy PMID: 23311395
  66. these results suggest that ID1 may be a new prognostic marker for Glioblastoma multiforme PMID: 23377983
  67. Results suggests a definite role for Id1 in mediating nicotine-induced proliferation and invasion of pancreatic cancer cells. PMID: 23308043
  68. Higher ID1 expression was associated with advanced breast cancer. PMID: 23645773
  69. using Bcl-3 knockdown in prostate cancer cells, identified the inhibitor of DNA-binding (Id) family of helix-loop-helix proteins as potential Bcl-3-regulated genes PMID: 22580608
  70. These findings suggest an essential role of Id1 and Id3 in TGFbeta1 effects on proliferation and migration in prostate cancer cells. PMID: 23060149
  71. Our results suggest that Id-1 regulates multiple tumor-promoting pathways in glioblastoma PMID: 23243024
  72. shRNA knockdown of ID1 attenuates androgen-stimulated hepatocellular carcinoma cell migration and invasion. PMID: 22819717
  73. It was shown that the ID1-p65 interaction modulates activation of the NF-kappa B signaling pathway. By affecting p65 nuclear translocation, ID1 was essential in regulating p65 recruitment to the promoter of cellular inhibitor of apoptosis protein 2. PMID: 22592405
  74. Silencing of Id-1 protein inhibited the growth of A375 cells. PMID: 22076920
  75. Data show that regulation of p21 by ID1 and ID3 is a central mechanism preventing the accumulation of excess DNA damage and subsequent functional exhaustion of cancer-initiating cells (C-ICs). PMID: 22698403
  76. Id1 shuttles between nucleus and cytoplasm, and promotes peritubular inflammation and tubular epithelial dedifferentiation, suggesting that these two events are intrinsically coupled during renal fibrogenesis. PMID: 22278018
  77. Notch activation provides Id1-expressing tumor cells with selective advantages in growth and survival PMID: 22393458
  78. High level of ID-1 expression suggested poor prognosis for patients with esophageal squamous cell carcinoma. PMID: 22480390
  79. combined analysis of Id-1 and NF-kappaB/p65 can be useful for identifying patients at risk for unfavorable clinical outcomes. Id-1 or/and NF-kappaB/p65 enhanced tumor cell migration, which is associated with the secretion of MMP-9 PMID: 22301282
  80. ID-1 is implicated in the pathogenesis and progression of gastric cancer. PMID: 21688151
  81. Results suggest that IL-3 plays an inhibitory role in osteoclast differentiation by regulating c-Fos and Id1, and also exerts anti-bone erosion effects. PMID: 21732357
  82. Acheron regulates vascular endothelial proliferation and angiogenesis together with Id1 during wound healing. PMID: 22139627
  83. These results demonstrate that Id1-induced beta1-integrin expression in endothelial cells and the function of Id1 in cell migration and tubulogenesis are dependent on p53. PMID: 21630092
  84. Bone morphogenetic proteins and ID1 exerted an anti-apoptotic effect in mesangial cells by inhibition of USF2 transcriptional activity. PMID: 21921026
  85. These results indicate that increased migration of MDA-MB-231 cells following cyclin D1 silencing can be mediated by Id1 and is linked to an increase in EMT markers. PMID: 21955753
  86. Inhibitor of differentiation 1 expression is correlated to human papillomavirus infection in cervical carcinoma. PMID: 21670698
  87. Older muscle contained significantly more transcript for Forkhead Box O 1 (FoxO1, p=0.001), Inhibitor of DNA binding 1 (ID1, p=0.009), and Inhibitor of DNA Binding 3 (ID3, p=0.043) than young muscle. PMID: 21993163
  88. Id1 could be considered as a prognostic predictor for stage III esophageal squamous cell carcinoma patients. PMID: 21896993
  89. Malignant rhabdoid tumors express many stem cell-associated transcription factors, which may be regulated by the expression of EZH2 and the Id family of proteins. PMID: 21921784
  90. Study revealed that Id1 interacts with LMP1 by binding to the CTAR1 domain of LMP1. N-terminal region of Id1 is required for the interaction with LMP1. PMID: 21701587
  91. ID1 was expressed in the nucleus in 70% of squamous cell carcinomas and 50% of non-squamous cell carcinomas and in vascular endothelium of non-tumor tissue PMID: 20709421
  92. Data show that ID1 is induced by nicotinic acetylcholine receptor (nAChR) and epidermal growth factor receptor (EGFR) signaling in a panel of NSCLC cell lines and primary cells from the lung. PMID: 21606196
  93. Study uniquely identifies ID1 and ID3 as negative regulators of the hPSC-hematopoietic transition from a hemogenic to a committed hematopoietic fate, and demonstrates that this is conserved between hESCs and hiPSCs. PMID: 21486943
  94. Nude mice study further confirmed an increased tumor growth in Id1-overexpressing cells and a decreased tumor growth in Id1-knockdowned cells. In conclusion, inactivation of Id1 may provide a novel strategy for treatment of lung cancer patients PMID: 21536374
  95. MUC18 is involved in cell signaling regulating the expression of Id-1 and ATF-3, thus contributing to melanoma metastasis PMID: 21467165
  96. The level of Id-1 protein expression was associated with the malignant potential of gastric tumors PMID: 20080245
  97. Induction of Id-1 by FGF-2 involves activity of EGR-1 and sensitizes neuroblastoma cells to cell death. PMID: 21506108
  98. Id-1 expression is at least partially regulated by HBx and may serve as a potential prognostic marker for HBV-related HCC. PMID: 20574154
  99. Id1 activation may need to occur at discrete stages in cooperation with additional gene dysregulation to repress and induce epigenetic silencing of tumor suppressor genes during melanoma progression. PMID: 20484992
  100. in human liver, not only HAMP, but also SMAD7 and Id1 mRNA significantly correlate with the extent of hepatic iron burden. However, this correlation is lost in patients with HFE-HC, but maintained in subjects with non-hemochromatotic iron overload. PMID: 20863724

Show More

Hide All

Subcellular Location Cytoplasm, Nucleus
Database Links

HGNC: 5360

OMIM: 600349

KEGG: hsa:3397

STRING: 9606.ENSP00000365280

UniGene: Hs.504609

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1