Recombinant Human E3 ubiquitin-protein ligase MIB1 (MIB1), partial

Code CSB-RP132874h
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
MIB1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
DAPK-interacting protein 1; Dip 1; DIP-1; Dip1; E3 ubiquitin protein ligase MIB 1; E3 ubiquitin protein ligase MIB1; E3 ubiquitin-protein ligase mib1; KIAA1323; LVNC7; MIB; mib1; MIB1_HUMAN; Mind bomb homolog 1; Mindbomb E3 ubiquitin protein ligase 1; Ubiquitin ligase mind bomb; Zinc finger ZZ type with ankyrin repeat domain protein 2; ZZANK2; ZZZ6
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
5-332aa
Target Protein Sequence
RNNRVMVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVVWDNGTAANYRCSGAYDLRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKCAECTNYDLCTVCYHGDKHHLRHRFYRITTPGSERVLLESRRKSKKITARGIFAGARVVRGVDWQWEDQDGGNGRRGKVTEIQDWSASSPHSAAYVLWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQ
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
40.1kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
E3 ubiquitin-protein ligase that mediates ubiquitination of Delta receptors, which act as ligands of Notch proteins. Positively regulates the Delta-mediated Notch signaling by ubiquitinating the intracellular domain of Delta, leading to endocytosis of Delta receptors. Probably mediates ubiquitination and subsequent proteasomal degradation of DAPK1, thereby antagonizing anti-apoptotic effects of DAPK1 to promote TNF-induced apoptosis. Involved in ubiquitination of centriolar satellite CEP131, CEP290 and PCM1 proteins and hence inhibits primary cilium formation in proliferating cells. Mediates 'Lys-63'-linked polyubiquitination of TBK1, which probably participates in kinase activation.
Gene References into Functions
  1. M1B-1 antigen was shown to increase the risk. High birth weight, pesticide exposure (childhood exposure, and parental occupational exposure) and maternal consumption of cured meat during pregnancy may also increase the risk of onset of childhood brain tumours PMID: 27212451
  2. In the absence of PCM1, Mib1 destabilizes Talpid3 through poly-ubiquitylation and suppresses cilium assembly. PMID: 27146717
  3. The aim of the study was to evaluate the caspase-3 and survivin expression in correlation with MIB-1 expression in gliomas of various grade. PMID: 26995334
  4. provided evidences that miR-10 regulates human endothelial cells behaviour through targeting Mib1 as well PMID: 26825552
  5. these results identify the interaction between Mib1 and Plk4 as a new and important element in the control of centriole homeostasis. PMID: 25795303
  6. Expression of MIB1 ligase protein, human was correlated with tumor grade and Figo stages. PMID: 26204652
  7. Data show how E3 ubiquitin protein ligase Mind bomb protein recognizes notch receptor ligands. PMID: 25747658
  8. a significant survival benefit for p16-positive vaginal cancers compared with p16-negative cancers for stages I and II. No difference was observed in survival for MIB-1-positive tumors PMID: 25319982
  9. Invasive adenomas have a higher inducible nitric oxide synthase, and this correlated with the MIB-1 PMID: 24008756
  10. This is the first published study ever assessing the expression of COX-2, p16 and Ki67 markers in ductal carcinoma in situ breast tumors. PMID: 25077370
  11. Data show that the E3 ubiquitin ligase, mind bomb 1 (Mib1), interacts with and ubiquitinates SMN and facilitates its degradation. PMID: 23615451
  12. MIB-1 was found to be associated with estrogen receptors in the stromal component PMID: 23442362
  13. implicate NOTCH signaling in left ventricular noncompaction and indicate that MIB1 mutations arrest chamber myocardium development, preventing trabecular maturation and compaction PMID: 23314057
  14. MIB1 negatively regulates TNFalpha- and IL1beta-induced NF-kappaB target gene activation PMID: 22184009
  15. RYK interacts both physically and functionally with the E3 ubiquitin MIB1. MIB1 is sufficient to activate Wnt/CTNNB1 signaling and this activity depends on endogenous RYK. PMID: 21875946
  16. Data demonstrate that c-mip interacts with Dip1 and upregulates DAPK, which blocks the nuclear translocation of ERK1/2. PMID: 20018188
  17. Neuralized-2 regulates a Notch ligand in cooperation with Mind bomb-1 PMID: 17003037
  18. DAPK is found in two distinct immune complexes, one containing HSP90 and CHIP and a second complex containing only DIP1/Mib; strict modulation of DAPK activities by HSP90 heterocomplexes is critical for regulation of apoptosis and cellular homeostasis PMID: 17324930
  19. Comparative genomic hybridization and immunohistochemical assessment of EGFR, PTEN, p53, and MIB-1 expression in 13 oligodendrogliomas, one oligoastrocytoma and 23 high-grade astrocytomas is reported. PMID: 17390041
  20. The interaction between Mib1 and cFLIP decreases the association of caspase-8 with cFLIP, which activates caspase-8 and induces cell death PMID: 19710364

Show More

Hide All

Involvement in disease
Left ventricular non-compaction 7 (LVNC7)
Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriolar satellite. Cell membrane.
Tissue Specificity
Widely expressed at low level. Expressed at higher level in spinal cord, ovary, whole brain, and all specific brain regions examined.
Database Links

HGNC: 21086

OMIM: 608677

KEGG: hsa:57534

STRING: 9606.ENSP00000261537

UniGene: Hs.140903

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*