Recombinant Human Enhancer of rudimentary homolog (ERH)

Code CSB-EP007785HUf0
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
ERH
Uniprot No.
Research Area
Cell Cycle
Alternative Names
DROER; Enhancer of rudimentary homolog (Drosophila); Enhancer of rudimentary homolog; ERH; ERH_HUMAN; FLJ27340; HGNC:3447
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-104aa
Target Protein Sequence
SHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
43.7kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May have a role in the cell cycle.
Gene References into Functions
  1. Data suggest that ERH interacts directly in nucleus with C-terminal Arg-Gly-rich region of SAFB1/SAFB2 and this multimer co-localizes in insoluble nuclear fraction; binding of ERH reverses inhibition exerted by SAFB1/SAFB2 on SRPK1. (ERH = enhancer of rudimentary homolog protein; SAFB = scaffold attachment factor B; SRPK1 = splicing kinase SR protein kinase-1) PMID: 28627136
  2. ERH regulation of RNA processing is needed to ensure faithful DNA replication and repair. PMID: 26100022
  3. REVIEW: recent findings indicate that ERH plays an important role in cell cycle through its mRNA splicing activity and is critically required for genomic stability and cancer cell survival PMID: 24078386
  4. Identification of amino acid residues of ERH required for its recruitment to nuclear speckles and replication foci PMID: 24015320
  5. Evolutionarily conserved protein ERH controls CENP-E mRNA splicing and is required for the survival of KRAS mutant cancer cells. PMID: 23236152
  6. ERH contributes to chromosome alignment at the metaphase plate by localizing CENP-E at kinetochore regions. PMID: 22704934
  7. molecular structure, dimerization and protein-protein interactions PMID: 15794639
  8. ERH may be an important transcription regulator that also functions in the control of cell-cycle progression. PMID: 17444515
  9. interaction with ERH could block the binding of p21(Cip1/Waf1) by Ciz1 in the cell. When ERH and Ciz1 are coexpressed in HeLa cells, Ciz1 recruits ERH to DNA replication foci PMID: 18081865
  10. Enhancer of rudimentary homolog (ERH) overexpression may be implicated in the initiation and/or progression of certain human malignancies. PMID: 18500978

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
E(R) family
Tissue Specificity
Expressed in all tissues examined.
Database Links

HGNC: 3447

OMIM: 601191

KEGG: hsa:2079

STRING: 9606.ENSP00000451080

UniGene: Hs.509791

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*