Recombinant Human Eukaryotic translation initiation factor 4E (EIF4E) (S209D,I63A,I79A)

Code CSB-EP007556HU(M2)e0
Abbreviation Recombinant Human EIF4E protein (S209D,I63A,I79A)
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-217aa(S209D,I63A,I79A)
Target Protein Sequence
ATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLASKFDTVEDFWALYNHAQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGDTTKNRFVV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
52.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures. In addition to its role in translation initiation, also acts as a regulator of translation and stability in the cytoplasm. Component of the CYFIP1-EIF4E-FMR1 complex which binds to the mRNA cap and mediates translational repression: in the complex, EIF4E mediates the binding to the mRNA cap. Component of a multiprotein complex that sequesters and represses translation of proneurogenic factors during neurogenesis. In P-bodies, component of a complex that mediates the storage of translationally inactive mRNAs in the cytoplasm and prevents their degradation. May play an important role in spermatogenesis through translational regulation of stage-specific mRNAs during germ cell development.
Gene References into Functions
  1. Mechanisms of translation initiation control via the eIF4E hub are pertinent to deregulated lymphoblastic activity. [review] PMID: 29527921
  2. High EIF4F expression is associated with malignant glioma. PMID: 30066885
  3. Our study...suggests that methylation of cg11037477 and expression of EIF4E may act as prognostic markers in gastric cancer PMID: 29342273
  4. Lack of regulation of the interaction between the eIF4E/eIF4G subunits of the translation initiation factor complex eIF4F is a hallmark of cancer. The inhibitor 4EGI-1 binds to eIF4E, thereby preventing association with eIF4G through an allosteric mechanism. Binding of 4EGI-1 perturbs native correlated motions and increases correlated fluctuations in part of the eIF4G binding site. PMID: 27162083
  5. The findings suggest that AEG-1 promotes gastric cancer metastasis through upregulation of eIF4E-mediated MMP-9 and Twist. PMID: 28661037
  6. The authors show that the eukaryotic translation initiation factor eIF4E, an oncoprotein, drives hyaluronan biosynthesis. eIF4E stimulates production of enzymes that synthesize the building blocks of hyaluronan, UDP-Glucuronic acid and UDP-N-Acetyl-Glucosamine, as well as hyaluronic acid synthase which forms the disaccharide chain. PMID: 29111978
  7. The present study indicated that miR-15a downregulation was associated with cell proliferation and invasion by directly targeting eIF4E during RCC progression. PMID: 28849086
  8. High expressions of eIF-4E are associated with advanced stage and poor prognosis. PMID: 28242042
  9. Our results indicate that AURKA plays an important role in the activation of EIF4E and cap-dependent translation. Targeting the AURKA-EIF4E-c-MYC axis using alisertib is a novel therapeutic strategy that can be applicable for everolimus-resistant tumors and/or subgroups of cancers that show overexpression of AURKA and activation of EIF4E and c-MYC PMID: 28073841
  10. Treatment with 240 mg/l matrine reduced the protein expression levels of PCNA and eIF4E. Matrine also reduced the migration ability of A549 cells and inhibited their proliferation, which may be associated with the overexpression of p53 and p21, and the reduction of PCNA and eIF4E expression levels. PMID: 28447756
  11. eIF4E and MMP9 expression in endometrial cancer specimens suggests their potential up-regulation during carcinogenesis. PMID: 29254314
  12. eIF4E promoted cholangiocarcinoma cell metastasis by up-regulating the expression of VEGF-C, MMP-2 and suppressing E-cadherin expression. PMID: 27907907
  13. Translational initiation pathway inhibition could be of clinical utility in male breast cancer patients overexpressing eIF4E and eIF5. With mTOR inhibitors that target this pathway now in the clinic, these biomarkers may represent new targets for therapeutic intervention, although further independent validation is required PMID: 27986751
  14. Data show association of eIF4E expression with chemotherapeutic response in esophageal squamous cell carcinoma (ESCC), and suggest that therapeutically targeting eIF4E may be a viable means of improving chemotherapy response in ESCC. PMID: 27588477
  15. We performed bioinformatics analyses of ESTs and the 3'UTRs of the main transcript splice variants of the translational initiation factor eIF4E1 and its family members, eIF4E2 and eIF4E3. We propose to elucidate the minor splice variants of eIF4E2 and eIF4E3 in great detail because they might produce proteins with modified features that fulfill different cellular roles from their major counterparts. PMID: 28942592
  16. EIF4E associated signaling pathways are associated with lymphangiogenesis and lymph node metastases of hypopharyngeal cancer. PMID: 29374693
  17. The authors show that LARP1 directly binds the cap and adjacent 5'TOP motif of TOP mRNAs, effectively impeding access of eIF4E to the cap and preventing eIF4F assembly. Thus, LARP1 is a specialized TOP mRNA cap-binding protein that controls ribosome biogenesis. PMID: 28379136
  18. Mitogen-activated protein kinase interacting protein kinases (Mnks) control translation by phosphorylation of eIF4E, whereas the mTOR kinase phosphorylates/de-activates the eIF4E inhibitor, 4E-BP1, to release translational repression. PMID: 27094611
  19. Elevated levels of p-Mnk1, p-eIF4E and p-p70S6K proteins are associated with tumor recurrence and poor prognosis in astrocytomas. Overexpression of p-eIF4E and co-expression of p-Mnk1, p-eIF4E and p-p70S6K proteins could be used as novel independent poor prognostic biomarkers for patients with astrocytomas. PMID: 27900644
  20. PRMT1 inhibition prevents gastric cancer progression by downregulating eIF4E and targeting type II PRMT5. PMID: 28987382
  21. MNK-1 controls chemokine secretion and proliferation in human airway smooth muscle cells. PMID: 27418099
  22. Data indicate that combinations of androgen receptor (AR) and mechanistic target of rapamycin (mTOR) inhibitors were effective in suppressing tumor growth including bicalutamide increased eukaryotic initiation factor 4E (eIF4E) phosphorylation. PMID: 28745319
  23. cell signaling pathways are activated in DIAs; peIF4E is an independent prognostic factor and a promising therapeutic target. PMID: 27440383
  24. Study identified and established the presence of an evolutionarily conserved water-bridge structural module which is an integral component of the recognition of the 5' mRNA cap by eIF4E during the process of translation initiation. PMID: 27916520
  25. Here, the authors identify the domains responsible for the eIF4E/human rhinovirus 2 2A(pro) interaction using molecular modelling and describe mutations that impair this interaction and delay in vitro cleavage of eIF4G isoforms. PMID: 28843814
  26. Results suggest that IGF2BP3 promotes eIF4E-mediated translational activation through the reduction of EIF4E-BP2 via mRNA degradation, leading to enhanced cell proliferation. PMID: 26522719
  27. There were significantly higher expressions of p-eIF4E and p-4EBP-1 proteins in the cases with lymph node metastasis than in those without lymph node metastasis. PMID: 28395726
  28. Our studies provide the first biochemical framework for the eIF4E-dependent mRNA export pathway. PMID: 28325843
  29. Human endogenous eIF4E1 and eIF4E2 behave under stresses similarly as their GFP-tagged counterparts. PMID: 27578149
  30. High EIF4E expression is associated with malignant peripheral nerve sheath tumors and vestibular schwannomas. PMID: 26951381
  31. The structures of eIF4E-eIF4G complexes reveal an extended interface to regulate translation initiation. PMID: 27773676
  32. 4E-BP1 has tumor suppressor activity by inhibiting eIF4E and, thus, blocking mRNA translation and proliferation. This is corroborated by elevated levels of phosphorylated and hence inactive 4E-BP1, which are detected in various cancers PMID: 26829052
  33. The studies suggest that MNK-eiF4E axis controls the translation of specific mRNAs in cancer metastasis and neuronal synaptic plasticity by a novel mechanism involving the regulation of the translational repressor, CYFIP1. (Review) PMID: 27527252
  34. Alternative eIF4F complexes taking part in protein biosynthesis have been described. (Review) PMID: 27283511
  35. Data show that galeterone (gal) and VNPT55 inhibit migration and invasion of prostate cancer cells, possibly by down-regulating protein expression via antagonizing the Mnk1/2-eIF4E axis. PMID: 27618366
  36. Findings suggest that miR-455-3p functions as a tumor suppressor by directly targeting eIF4E in prostate carcinogenesis. PMID: 28350134
  37. Data show that targeting translation initiation (TI) factors eIF4E/eIF4GI reduces migration and epithelial-to-mesenchymal transition (EMT), both essential for metastasis, thereby underscoring the potential of TI targeting in non-small cell lung cancer (NSCLC) therapy. PMID: 27501049
  38. p4E-BP1 may identify male breast cancers potentially suitable for therapies directed at the upstream kinase, mTOR PMID: 27280636
  39. eIF4E and mTOR depletion significantly enhances the anti-proliferative and pro-apoptotic effects of paclitaxel, demonstrating the critical role of eIF4E in oral tongue squamous cell carcinoma cell response to paclitaxel PMID: 27932243
  40. data suggest a physiological role for MNK1a-Ser(353) phosphorylation in regulation of the MNK1a kinase, which correlates with increased eIF4E phosphorylation in vitro and in vivo. PMID: 27413184
  41. eIF4E may play an important role in the development and metastasis of hypopharyngeal carcinoma; its expression may be helpful in establishing the diagnosis, stage and prognosis of this tumour type. PMID: 24840750
  42. First study showing the induction of miR-141/EIF4E expression in an acquired model of docetaxel chemoresistant patients with non-small cell lung cancer. PMID: 27840955
  43. miR503 may increase sensitivity to therapies at least partially through targeting EIF4E suppression of Hepatocellular carcinoma proliferation. PMID: 27840964
  44. suggests that selective inhibition of translation of YB-1 mRNA, and probably some other mRNAs as well, by mTOR kinase inhibitors is not mediated by the action of the 4E-binding protein upon functions of the 4F-group translation initiation factors PMID: 26931209
  45. eIF4E protein might result in the malignant progression of hepatocellular carcinoma, and its overexpression may be a powerful prognostic biomarker. PMID: 27601163
  46. HSP27 was found to be regulator of translation initiation and STAT3 level. Therefore, it suggests that HSP27 is a key protein during placental development and trophoblast cell differentiation. PMID: 27714564
  47. Cercosporamide acts as a Mnk inhibitor to block eIF4E phosphorylation and selectively suppresses angiogenesis, growth and survival of human hepatocellular. PMID: 27662474
  48. Our studies also suggest that nuclear entry is important for the prooncogenic activity of eIF4E, at least in this context. These findings position nuclear trafficking of eIF4E as a critical step in its regulation and position the importin 8-eIF4E complex as a novel therapeutic target. PMID: 27114554
  49. Two distinct cap-dependent protein synthesis machineries select mRNAs for translation: the normoxic eIF4F and the hypoxic eIF4Fhigh. PMID: 26854219
  50. This study demonstrates that the activation of eIF4E gene is an essential component of the malignant phenotype in ovarian cancer PMID: 26498997

Show More

Hide All

Involvement in disease
Autism 19 (AUTS19)
Subcellular Location
Cytoplasm, P-body. Cytoplasm. Cytoplasm, Stress granule. Nucleus.
Protein Families
Eukaryotic initiation factor 4E family
Database Links

HGNC: 3287

OMIM: 133440

KEGG: hsa:1977

UniGene: Hs.13211

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*