Recombinant Human HLA class I histocompatibility antigen, alpha chain G(HLA-G)

In Stock
Code CSB-EP010509HUa2
Product Type Recombinant Protein
Size US$1726Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P17693
Relevance Involved in the presentation of foreign antigens to the immune syst. Plays a role in maternal tolerance of the fetus by mediating protection from the deleterious effects of natural killer cells, cytotoxic T-lymphocytes, macrophages and mononuclear cells.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Alias HLA G antigen;MHC class I antigen G
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
Research Area Immunology
Source E.coli
Gene Names HLA-G
Expression Region 25-338aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 51.6kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the presentation of foreign antigens to the immune system. Plays a role in maternal tolerance of the fetus by mediating protection from the deleterious effects of natural killer cells, cytotoxic T-lymphocytes, macrophages and mononuclear cells.
Subcellular Location Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 3: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 4: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 5: Secreted, SUBCELLULAR LOCATION: Isoform 6: Secreted, SUBCELLULAR LOCATION: Isoform 7: Secreted
Protein Families MHC class I family
Tissue Specificity Expressed in trophoblasts. Expressed in fetal eye and thymus (PubMed:2336406). Also expressed in adult eye (PubMed:1570318). Isoform 4: Expressed in fetal first trimester trophoblasts (PubMed:7589701). Isoform 7: Expressed in first trimester, second trime
Database Links

HGNC: 4964

OMIM: 142871

KEGG: hsa:3135

STRING: 9606.ENSP00000353472

UniGene: Hs.512152

Pathway Cellular senescence
Antigen processing and presentation
Natural killer cell mediated cytotoxicity
Endocytosis

Related Products

HLA-G Antibodies

HLA-G Antibodies for Human

HLA-G ELISA Kit

HLA-G ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.