Recombinant Human IgG receptor FcRn large subunit p51(FCGRT)

Product Type Recombinant Protein
Uniprot No. P55899
Species Homo sapiens (Human)
Research Area Immunology
Gene Names FCGRT
Protein Names Recommended name: IgG receptor FcRn large subunit p51 Short name= FcRn Alternative name(s): IgG Fc fragment receptor transporter alpha chain Neonatal Fc receptor
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Binds to the Fc region of monomeric immunoglobulins gamma
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families Immunoglobulin superfamily
Tissue Specificity Expressed in full-term placenta, heart, lung, liver, muscle, kidney, pancreas, and both fetal and adult small intestine.
Database Links

HGNC: 3621

OMIM: 601437

KEGG: hsa:2217

STRING: 9606.ENSP00000221466

UniGene: Hs.111903

Product Details for Different Expression Systems

Product Name Recombinant Human IgG receptor FcRn large subunit p51(FCGRT),Yeast
Code CSB-YP008545HU
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS
Expression Region 24-297aa
Protein Description Extracellular domain
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

FCGRT Antibodies

FCGRT Antibodies for Human

FCGRT Antibodies for Homo sapiens (Human)

FCGRT Proteins

FCGRT Proteins for Homo sapiens (Human)

FCGRT ELISA Kit

FCGRT ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.