Recombinant Human IgG receptor FcRn large subunit p51(FCGRT),partial

In Stock
Code CSB-MP008545HU
Product Type Recombinant Protein
Size US$1232Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P55899
Lead Time 3-7 business days
Relevance Binds to the Fc region of monomeric immunoglobulins gamma. Mediates the uptake of IgG from milk. Possible role in transfer of immunoglobulin G from mother to fetus.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias IgG Fc fragment receptor transporter alpha chainNeonatal Fc receptor
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS
Research Area Immunology
Source Mammalian cell
Gene Names FCGRT
Expression Region 24-297aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 34.4kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Binds to the Fc region of monomeric immunoglobulins gamma
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families Immunoglobulin superfamily
Tissue Specificity Expressed in full-term placenta, heart, lung, liver, muscle, kidney, pancreas, and both fetal and adult small intestine.
Database Links

HGNC: 3621

OMIM: 601437

KEGG: hsa:2217

STRING: 9606.ENSP00000221466

UniGene: Hs.111903

Related Products

FCGRT Antibodies

FCGRT Antibodies for Human

FCGRT Antibodies for Homo sapiens (Human)

FCGRT ELISA Kit

FCGRT ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.