Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-MP008545HU |
| Product Type | Recombinant Protein |
| Size |
US$1232Purchase it in Cusabio online store (only available for customers from the US) |
| Uniprot No. | P55899 |
| Lead Time | 3-7 business days |
| Relevance | Binds to the Fc region of monomeric immunoglobulins gamma. Mediates the uptake of IgG from milk. Possible role in transfer of immunoglobulin G from mother to fetus. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | IgG Fc fragment receptor transporter alpha chainNeonatal Fc receptor |
| Species | Homo sapiens (Human) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS |
| Research Area | Immunology |
| Source | Mammalian cell |
| Gene Names | FCGRT |
| Expression Region | 24-297aa |
| Tag Info | N-terminal 6xHis-tagged |
| Mol. Weight | 34.4kDa |
| Protein Description | Partial |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Binds to the Fc region of monomeric immunoglobulins gamma |
| Subcellular Location | Cell membrane, Single-pass type I membrane protein |
| Protein Families | Immunoglobulin superfamily |
| Tissue Specificity | Expressed in full-term placenta, heart, lung, liver, muscle, kidney, pancreas, and both fetal and adult small intestine. |
| Database Links |
HGNC: 3621 OMIM: 601437 KEGG: hsa:2217 STRING: 9606.ENSP00000221466 UniGene: Hs.111903 |
FCGRT Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA008545ED01HU | FCGRT Antibody, Biotin conjugated | Human | ELISA |
| CSB-PA008545EC01HU | FCGRT Antibody, FITC conjugated | Human | ELISA |
| CSB-PA008545EB01HU | FCGRT Antibody, HRP conjugated | Human | ELISA |
| CSB-PA008545EA01HU | FCGRT Antibody | Human, Mouse | ELISA, WB, IHC, IF |
FCGRT Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA008545GA01HU | FCGRT Antibody | Human | ELISA,WB |
FCGRT Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-EP008545HU | Recombinant Human IgG receptor FcRn large subunit p51(FCGRT),partial | E.coli |
| CSB-YP008545HU | Recombinant Human IgG receptor FcRn large subunit p51(FCGRT),partial | Yeast |
| Recombinant Human IgG receptor FcRn large subunit p51(FCGRT) |
FCGRT ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-EL008545HU | Human IgG receptor FcRn large subunit p51(FCGRT) ELISA kit | serum, plasma, tissue homogenates | 3.9 pg/mL |
Recombinant Bovine Pulmonary surfactant-associated protein C(SFTPC)
Express system: E.coli
Species: Bos taurus (Bovine)
Recombinant Human 28S ribosomal protein S22, mitochondrial(MRPS22)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rabbit Apolipoprotein E(APOE),partial
Express system: E.coli
Species: Oryctolagus cuniculus (Rabbit)
Recombinant Human Cytochrome P450 11B1, mitochondrial(CYP11B1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Proteasome subunit beta type-8(PSMB8)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Potassium-transporting ATPase subunit beta(ATP4B),Partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human CCAAT/enhancer-binding protein gamma(CEBPG)
Express system: E.coli
Species: Homo sapiens (Human)
