Recombinant Human Integrin beta-3 (ITGB3), partial

Code CSB-YP011885HU1
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP011885HU1
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP011885HU1-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP011885HU1
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP011885HU1
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
ITGB3; GP3A; Integrin beta-3; Platelet membrane glycoprotein IIIa; GPIIIa; CD antigen CD61
Species
Homo sapiens (Human)
Expression Region
385-490
Target Protein Sequence
VRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGP
Protein Length
Extracellular domain
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Integrin alpha-V/beta-3 (ITGAV:ITGB3) is a receptor for cytotactin, fibronectin, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin, vitronectin and von Willebrand factor. Integrin alpha-IIb/beta-3 (ITGA2B:ITGB3) is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. Integrins alpha-IIb/beta-3 and alpha-V/beta-3 recognize the sequence R-G-D in a wide array of ligands. Integrin alpha-IIb/beta-3 recognizes the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin alpha-IIb/beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen. This step leads to rapid platelet aggregation which physically plugs ruptured endothelial surface. Fibrinogen binding enhances SELP expression in activated platelets. ITGAV:ITGB3 binds to fractalkine (CX3CL1) and acts as its coreceptor in CX3CR1-dependent fractalkine signaling. ITGAV:ITGB3 binds to NRG1 (via EGF domain) and this binding is essential for NRG1-ERBB signaling. ITGAV:ITGB3 binds to FGF1 and this binding is essential for FGF1 signaling. ITGAV:ITGB3 binds to FGF2 and this binding is essential for FGF2 signaling. ITGAV:ITGB3 binds to IGF1 and this binding is essential for IGF1 signaling. ITGAV:ITGB3 binds to IGF2 and this binding is essential for IGF2 signaling. ITGAV:ITGB3 binds to IL1B and this binding is essential for IL1B signaling. ITGAV:ITGB3 binds to PLA2G2A via a site (site 2) which is distinct from the classical ligand-binding site (site 1) and this induces integrin conformational changes and enhanced ligand binding to site 1. ITGAV:ITGB3 acts as a receptor for fibrillin-1 (FBN1) and mediates R-G-D-dependent cell adhesion to FBN1. In brain, plays a role in synaptic transmission and plasticity. Involved in the regulation of the serotonin neurotransmission, is required to localize to specific compartments within the synapse the serotonin receptor SLC6A4 and for an appropriate reuptake of serotonin. Controls excitatory synaptic strength by regulating GRIA2-containing AMPAR endocytosis, which affects AMPAR abundance and composition. ITGAV:ITGB3 act as a receptor for CD40LG.; (Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for Herpes virus 8/HHV-8.; (Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for Coxsackievirus A9.; (Microbial infection) Acts as a receptor for Hantaan virus.; (Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for Cytomegalovirus/HHV-5.; (Microbial infection) Integrin ITGA5:ITGB3 acts as a receptor for Human metapneumovirus.; (Microbial infection) Integrin ITGAV:ITGB3 acts aP05556s a receptor for Human parechovirus 1.; (Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for West nile virus.; (Microbial infection) In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions.
Gene References into Functions
  1. ApoA-IV is a novel ligand of platelet GPIIB IIIA integrin PMID: 30190457
  2. The analysis of the effect of the individual SNPs(PON1, IL-6, ITGB3, and ALDH2 ) and GRS groups on different lipid profile parameters revealed no significant association of any of the tested SNPs with any lipid parameter, however, the GRS groups showed marginally significant for TC and highly significant association for TG, LDL-c and HDL-c PMID: 30261890
  3. The adenosine deaminase RNA-specific binding protein (ADAR1)-dependent and RNA-editing-independent regulation of invasion, mediated by Integrin beta3 (ITGB3) suggests a central involvement of ADAR1 in cancer progression and metastasis. PMID: 29855470
  4. This study shows that Leu33Pro polymorphism of integrin beta 3 modulates platelet Src pY418 and focal adhesion kinase pY397 phosphorylation in response to abnormally high shear stress. Whereas physiological shear stress does not affect platelet signaling, abnormally high-shear stress considerably elevates Src and FAK phosphorylation in both Pro33 and Leu33 platelets. PMID: 29965811
  5. ITGB3 gene mutations associated with Glanzmann thrombasthenia (Review) PMID: 29125375
  6. Autonomous conformational regulation of beta3 integrin and the conformation-dependent property of HPA-1a alloantibodies. PMID: 30209215
  7. The results showed a significant upregulation of ECM1 and ITGB3, and a significant downregulation for FBLN5 in pelvic organ prolapse patients. PMID: 29729708
  8. We discovered an infection mechanism that requires HS and EphA2 but is independent of alphaV- and beta1-family integrin expression. PMID: 29899108
  9. ITGB3 is the mainly affected gene impaired in the patients with Glanzmann's thrombasthenia. GPIIb/IIIa complex was disrupted due to mutations in all type-I Glanzmann's thrombasthenia patients PMID: 29084015
  10. Cancer-associated fibroblasts and CD61+ expression were found to be good negative prognosis factors for invasive breast cancer patients. PMID: 28935175
  11. Carriage of genetic variant rs5918(C) polymorphism in ITGB3 gene in women contributes to higher risk of single and recurrent DVT events at younger age. PMID: 26739544
  12. Type I Glanzmann thrombasthenia (GT)was found most common in our patients and with lowered mean CD41 expression in comparison with CD61. Type III GT patients had significantly lower numbers of severe bleeders, but the severity of bleeding did not vary significantly in type I and II GT patients. PMID: 28948953
  13. The expression of H19 lncRNA and integrin beta3 protein were down-regulated in the RIF [repeated implantation failure] patients. PMID: 28791461
  14. Data suggest that genetic deletion in ITGB3 [p.T720del] can result in autosomal dominant macrothrombocytopenia with platelet aggregation dysfunction; this study was conducted in a womand and her sons in Japan. [CASE REPORT] PMID: 29380037
  15. more pronounced level of platelet activation was found in polymorphism carriers. In conclusion, the carriage of PlA2 allele modulates the activation state, morphology, and membrane elasticity of platelets. PMID: 28081621
  16. ITGbeta3 and CD44 expression levels determine whether OPN-a inhibits or enhances growth in lung cancer cells. PMID: 27487131
  17. GpIIIa gene polymorphism was associated with early onset coronary artery disease and increased risk of myocardial infarction. PMID: 27805237
  18. No genetic abnormalities identified in alpha2IIb and beta3: phenotype overcomes genotype in Glanzmann thrombasthenia PMID: 27808476
  19. ITGB3 (integrin beta 3 or beta3) is regulated by the Polycomb protein CBX7. PMID: 28273461
  20. Integrin-beta3 is the major driver for fibronectin assembly in cancer-associated fibroblasts, as its inhibition abrogates CAF mediated cancer cell invasion. PMID: 28931556
  21. our finding that CD61 is conservative in defining HECs both in vitro for hPSC differentiation and in vivo for mouse embryo provides valuable information on how to define and access the bipotent HECs. PMID: 27746115
  22. The mechanism of resistance of tongue squamous carcinoma cells Cal27 with de novo integrin alphavbeta3 expression to anticancer drugs was studied. In Cal27 cells integrin alphav heterodimers signal through pSrc(Y418) while this is not the case in integrin alphavbeta3-expressing cells. Overexpression of integrin subunit beta3 gene in Cal27 cells leads to the de novo expression of integrin alphavbeta3 and increased expre... PMID: 27108184
  23. These findings bring attention to the effects of C-terminal carboxylmethylation on RAB GTPases and provide a rationale for targeting ICMT in the treatment of metastatic cancer PMID: 28604748
  24. From these data, we suggest that filamentous vimentin underneath the plasma membrane is involved in increasing integrin adhesiveness, and thus regulation of the vimentin-integrin interaction might control cell adhesion PMID: 27044755
  25. Data suggest that talin increases embedding of integrin-beta-3 (ITGB3) transmembrane domain into lipid bilayer, resulting in activation of integrin-alpha-IIb beta-3 (ITGA2B/ITGB3); phyto-antioxidant EGCG (epigallocatechin gallate) decreases this embedding, thus opposing talin-induced integrin activation. However, EGCG activates ITGA2B/ITGB3 in the absence of talin both in a purified system and in CHO cells. PMID: 28487468
  26. Recombinant platelet membrane glycoprotein IIIa (GPa) was successfully obtained and used to establish a Luminex technology-based method for the detection of HPA-1a-specific antibodies. PMID: 28186591
  27. In contrast to HLA-DRB4*01:01P, the inheritance of HLA-DRB3*01:01 is strongly associated with the propensity for mounting a humoral immune response against fetal HPA-1a antigen. PMID: 28019029
  28. These results identify beta3 integrin signaling via repression of BAD as an important survival pathway used by breast cancer cells to evade chemotherapy induced stress. PMID: 27235542
  29. Low ITGB3 expression is associated with ovarian cancer. PMID: 27633757
  30. ITGB3 expression is significantly upregulated in human masticatory mucosa during wound healing PMID: 28005267
  31. Early neurological deterioration (END) occurred significantly more frequently in patients with aspirin resistance (AR) or high-risk interactive genotypes. Moreover, AR and high-risk interactive genotypes were independently associated with END. PMID: 28068952
  32. Suggest that ERK1/2 plays an important role in mediating non-canonical TGFbeta signal pathways for integrin beta3 expression in mesenchymal tumor cells. PMID: 27085460
  33. Recently, new clinical observations of genetic diseases provided evidence bringing new data on the role of alphaIIbbeta3 integrin in defective megakaryopoiesis.[review] PMID: 27011248
  34. MiR-30a-5p suppresses tumor metastasis of human colorectal cancer by targeting ITGB3. PMID: 27576787
  35. GPIIIa polymorphism was not associated with poor responsiveness to clopidogrel in coronary heart disease patients of Han ethnicity. PMID: 27488401
  36. study identified the rs3809865 A/A genotype as an independent risk factor for venous thromboembolism in colorectal cancer patients PMID: 26440977
  37. beta3 integrin downregulation by miR-30a-5p modulates cell adhesion and invasion by interrupting Erk/Ets1 network in triple-negative breast cancer PMID: 26781040
  38. Data show that integrin beta3 and serine/threonine-protein kinase LKB1 are involved in the inhibition of proliferation by lovastatin independently. PMID: 26517522
  39. EGFRvIII/integrin beta3 interaction in hypoxic and vitronectinenriching microenvironment promote Glioblastoma progression and metastasis. PMID: 26717039
  40. There are no relationships between glycoprotein IIIa P1A1/A2 polymorphism, aspirin resistance and development of atherothrombotic stroke. PMID: 26809135
  41. T4, but not T3, controls integrin's outside-in signaling by phosphorylating tyrosine 759 in the beta3 subunit. ERK-mediated transcription regulation of the b3 monomer is regulated by T3 and T4which are alphavbeta3-ligands driving ovarian cancer cell proliferation . PMID: 26165836
  42. Our data provide evidence that ADAM23 plays a role in suppression of cancer cell progression through interaction with aVb3 integrin, and suggest that downregulation of ADAM23 in SP cells may contribute toward providing a cancer stem cell phenotype PMID: 26800504
  43. Up-regulation of integrin beta3 is associated with endometrial cancer. PMID: 26384307
  44. CD61-overexpressing human umbilical cord mesenchymal stem cell, which had turned into primordial germ-like cells-like cells, could be further differentiated into male germ-like cells. PMID: 26840189
  45. The frequencies of the rare alleles of CCR2, ITGB3, and 3'UTR of c-fms in the Old Believers are lower than in the sample of Novosibirsk Russians, and the rare allele of DBH is more frequent PMID: 27239844
  46. results demonstrate that beta3 integrin expression depends on the source of the fibroblast and that its expression inhibits alphaSMA expression (and thus the myofibroblast phenotype). PMID: 25926101
  47. 33Leu --> Pro substitution of GPIIIa does not influence the prevalence and extent of angiographically defined coronary artery disease in general population, although apparently playing a role among younger patients. PMID: 25167197
  48. ITGB3 expression increased with matrix rigidity. Blocking Ibeta3 reduced Gli2 and PTHrP expression. Ibeta3 co-localized with TGF-beta RII on rigid but not compliant films. PMID: 26115412
  49. ITGB3 c.1476G>A mutation decrease the transcription level and affect GPIIIa synthesis and CD61 antigen expression. PMID: 26829726
  50. GpIIIa 1565T/C and homozygous MTHFR 677C/T polymorphisms were higher in DVT patients compared with the control group (OR=6.65, 95% CI=3.09-14.30 and OR=4.08, 95% CI=1.35-12.38, respectively). PMID: 26261166

Show More

Hide All

Involvement in disease
Glanzmann thrombasthenia (GT); Bleeding disorder, platelet-type 16 (BDPLT16)
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell projection, lamellipodium membrane. Cell junction, focal adhesion. Cell junction, synapse, postsynaptic cell membrane; Single-pass type I membrane protein. Cell junction, synapse.
Protein Families
Integrin beta chain family
Tissue Specificity
Isoform beta-3A and isoform beta-3C are widely expressed. Isoform beta-3A is specifically expressed in osteoblast cells; isoform beta-3C is specifically expressed in prostate and testis.
Database Links

HGNC: 6156

OMIM: 173470

KEGG: hsa:3690

STRING: 9606.ENSP00000262017

UniGene: Hs.218040

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1