Recombinant Human Interleukin-1 receptor type 1 (IL1R1), partial, Biotinylated

Code CSB-MP011621HU1-B
Abbreviation Recombinant Human IL1R1 protein, partial, Biotinylated
MSDS
Size $118
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • The purity of IL1R1 was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
CD121 antigen-like family member A;Interleukin-1 receptor alpha;Interleukin-1 receptor type I;p80
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
21-332aa
Target Protein Sequence
DKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
40.8 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-Avi-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for IL1A, IL1B and IL1RN. After binding to interleukin-1 associates with the coreceptor IL1RAP to form the high affinity interleukin-1 receptor complex which mediates interleukin-1-dependent activation of NF-kappa-B, MAPK and other pathways. Signaling involves the recruitment of adapter molecules such as TOLLIP, MYD88, and IRAK1 or IRAK2 via the respective TIR domains of the receptor/coreceptor subunits. Binds ligands with comparable affinity and binding of antagonist IL1RN prevents association with IL1RAP to form a signaling complex. Involved in IL1B-mediated costimulation of IFNG production from T-helper 1 (Th1) cells.
Gene References into Functions
  1. interleukin-1 receptor 1/MyD88 signalling has roles in the development and progression of pulmonary hypertension PMID: 27418552
  2. Study highlights the association of genetic polymorphisms of IL1R1 with knee osteoarthritis susceptibility in the Northwestern Chinese Han population. PMID: 27980229
  3. Serum ST2 is elevated in heart failure patients and correlated with disease severity. PMID: 28164491
  4. Since mumps virus SH coimmunoprecipitated with tumor necrosis factor receptor 1 (TNFR1), RIP1, and IRAK1, we hypothesize that SH exerts its NF-kappaB activation inhibitory function by interacting with TNFR1, interleukin-1 receptor type 1 (IL-1R1), and TLR3 complexes in the plasma membrane of infected cells. PMID: 28659487
  5. salt-inducible kinase inhibition decreases proinflammatory cytokines in human myeloid cells upon IL-1R stimulation. PMID: 26590148
  6. study confirmed that genetic variant in IL-1R1(rs3917267) has significant association with HBV infection and HBV breakthrough infection in children, which provides new clues for the study of pathogenesis of chronic HBV infection in children PMID: 28027994
  7. The results present identification of critical regions within the TIR domain of IL-1 receptor type in humans and mice. PMID: 26279140
  8. IL1R1 SNP rs949963 is associated with the susceptibility to asthma in children from Central China and may increase the serum expression of IL1R1. PMID: 26975823
  9. investigated the association between four inflammatory cytokines (CD121a, interleukin [IL]-1beta, IL-8, and IL-11) and coronary heart disease PMID: 26098632
  10. This study found that the mRNA expression of IL-1R1, TNFR1, and TNFR2 was significantly higher in schizophreina PMID: 25749018
  11. IL-1R1 expression appears to define a tissue regulatory T cell phenotype together with the expression of CD25, glucocorticoid-induced tumor necrosis factor receptor family-related gene and CTLA-4. PMID: 26076982
  12. TNF-alpha (-308) GG, IL-10 (-819) TT, IL-10 (-1082) GG and IL1R (+1970) CC genotypes are found to be predominant (p=0.01, p=0.02, p=0.0001 and p=0.001, respectively) in both tuberculoid as well as lepromatous leprosy patients. PMID: 25697140
  13. IL-1 receptor gene polymorphisms could be one of the factors influencing the expression of membrane-bound IL-1 receptors on immunocompetent cells. PMID: 24976267
  14. severe forms of pancreatitis are associated with increased levels of IL-6, IL-10 and IL-1ra PMID: 25240697
  15. SUMOylation is a novel mechanism in the regulation of beta-arrestin 2-mediated IL-1R/TRAF6 signaling PMID: 25425640
  16. genetic polymorphism is associated with atopic dermatitis in Iranian pediatric population PMID: 23253688
  17. Blood monocytes from renal cell carcinoma patients displayed a tumor-promoting transcriptional profile that supported functions like angiogenesis and invasion. Induction of this protumor phenotype required an interleukin-1 receptor (IL-1R)-dependent mechanism. PMID: 25453823
  18. the NLRP3 inflammasome/IL-1RI axis is dispensable for PM10-facilitated allergic sensitization. PMID: 24988285
  19. Thirty-eight single nucleotide polymorphisms (SNPs) were identified within genomic regions containing all exons and relevant exon-intron boundaries in IL1R1 and IL1R2 in japanese aggressive periodontitis. PMID: 24818754
  20. Only the IL1RN tandem repeats polymorphism may be associated with Hashimoto's thyroiditis susceptibility; TSHR and IL1RN polymorphisms may represent prognostic factors for predicting the severity of the disease. PMID: 24328419
  21. ). Findings provide evidence of subgroups of women with breast cancer who report distinct trajectories of attentional function and of a genetic association between subgroup membership and an IL1R1 promoter polymorphism. PMID: 24315345
  22. No significant differences are detected in the Fcgamma-RIIa and IL1-Ra polymorphisms compared to controls in a study to search for associations between antineutrophil cytoplasm antibody-associated vasculitis and IL1R1 polymorphisms. PMID: 24356554
  23. results demonstrate clear functional consequences of the rs917997 risk polymorphism; this polymorphism leads to a loss-of-function through decreased IL-18RAP, IL-18R1, and IL-1R1 protein expression, which impairs autocrine IL-18 and IL-1 signaling PMID: 24842757
  24. The frequency of the IL-1RN rs315952 CT genotype was significantly lower among patients with systemic lupus erythematosus compared with healthy controls PMID: 23722873
  25. Common IL-33 and IL1RL1 polymorphisms contribute to the risk of inflammatory bowel disease PMID: 23634226
  26. The IL1R1 promoter SNP rs2192752 may contribute to the location of papillary thyroid carcinoma (PTC), and the C allele of rs2192752 may be a risk factor for the development of PTC in both lobes. PMID: 22594576
  27. These results demonstrate that IL-1alpha and IL-1R1 signaling is essential for microabscess formation, neutrophil recruiting chemokine expression, and acanthosis in psoriasis-like skin inflammation induced by imiquimod. PMID: 23407395
  28. The internalization of IL1RI after IL-1 binding is not a mechanism of feedback inhibition but of critical importance for the IL-1-induced gene expression. PMID: 23022958
  29. Analysis of the data suggested that IL-1R1 expression in the neonatal period provides an additional level of Myd88-dependent signaling during this period of heighted susceptibility to infection. PMID: 22435759
  30. The IL-1R1 1498T>C polymorphism is associated with early-stage endometriosis in Korean women. PMID: 22509941
  31. a genetic link between rs1921622 IL1RL1 polymorphism and disease severity in RSV bronchiolitis PMID: 22574108
  32. This study demonistrated that Carriers of the minor allele for a single nucleotide polymorphism in interleukin (IL)1-receptor 1 (IL1R1) (rs2110726) were less likely to report breast pain prior to surgery PMID: 22515947
  33. the LCAP related changes in sIL-1RI and IL-1Ra might impact the clinical outcome during treatment with an LCAP filter in patients with inflammatory bowel disease PMID: 22267087
  34. No sufficient evidence was available to support any associations between IL1-Ra and IL6-147G/C polymorphisms and ischemic stroke. PMID: 22417897
  35. a role for TILRR in selective amplification of NF-kappaB responses through IL-1RI and suggest that the specificity is determined by changes in receptor conformation and adapter protein recruitment. PMID: 22262840
  36. The study presents the crystal structure of IL-1beta bound to its primary receptor IL-1RI and its receptor accessory protein IL-1RAcP. PMID: 22426547
  37. data demonstrated that IL-1R polymorphism is associated with susceptibility to ankylosing spondylitis PMID: 22285486
  38. regulates S100A8/A9-dependent keratinocyte resistance to bacterial invasion PMID: 22031183
  39. findings demonstrate that neutrophils express IL-1R1 and that IL-1R1 is induced following extravasation and exists in a mobile intracellular compartment PMID: 22385245
  40. Data sshow that variants in SFTPD, CD46 and IL1R1 are associated with IPD in both EA and AA. PMID: 21858107
  41. IL-1RI expression in regulatory T (Treg)cells identifies a subpopulation at an early stage of differentiation. PMID: 21998454
  42. This study found for the first time an epigallocatechin gallate-induced downregulation of the IL-1RI expression possibly being caused by NF-kappaB inhibition. PMID: 21787753
  43. IL-1RI expression was not altered in endometrioid carcinoma cells in comparison with endometrial cells, clear-cells, serous and mucinous ovarian cancer cells. PMID: 21083841
  44. Interleukin-1 receptor-mediated inflammation impairs the heat shock response of human mesothelial cells PMID: 21435443
  45. No association was found between recurrent spontaneous abortion and gene polymorphisms in the interleukin-1 receptor 1 gene. PMID: 20956022
  46. IL1RL1 polymorphisms are associated with serum IL1RL1-a, blood eosinophils, and asthma in childhood PMID: 21281963
  47. Serum levels of ECP, IL-5, -6, -8 and -10, G-CSF, MCP-1, IL-1 ra and IP-10 were significantly elevated in acute compared with stable childhhood asthma. PMID: 20523065
  48. This study indicated that statistically significant higher protein and mRNA levels of the il1r in frontal corte in bipolar disorder. PMID: 19488045
  49. findings that human Tregs preferentially express receptors for TNF and IL-1 suggest a potential function in sensing and dampening local inflammation PMID: 20066156
  50. An association between severe hand osteoarthritis and IL1R1 gene. PMID: 20353565

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein. Cell membrane. Secreted.
Protein Families
Interleukin-1 receptor family
Tissue Specificity
Expressed in T-helper cell subsets. Preferentially expressed in T-helper 1 (Th1) cells.
Database Links

HGNC: 5993

OMIM: 147810

KEGG: hsa:3554

STRING: 9606.ENSP00000233946

UniGene: Hs.701982

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*