Recombinant Human Interleukin-12 subunit beta (IL12B)

Code CSB-EP011587HU
Abbreviation Recombinant Human IL12B protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
CLMF ; CLMF p40; CLMF2; Cytotoxic lymphocyte maturation factor 40 kDa subunit; IL 12B; IL-12 subunit p40; IL-12B; IL12 p40; IL12B; IL12B_HUMAN; IMD28; IMD29; Interleukin 12 beta chain; Interleukin 12 p40; Interleukin-12 subunit beta; NK cell stimulatory factor chain 2; NKSF ; NKSF2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
23-328aa
Target Protein Sequence
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
61.7kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.; Associates with IL23A to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
Gene References into Functions
  1. Effect of polymorphisms in IL-12B p40, IL-17A and IL-23 A/G genes on the response of psoriatic patients to narrowband UVB. PMID: 29763989
  2. showed that IL-12B A1188C (rs3212227) can contribute to the progression of the disease in the Czech population PMID: 30069682
  3. Study confirms an association between IL12B and IL23R genetic polymorphism and psoriasis vulgaris (with a protective effect of minor alleles). PMID: 29454820
  4. IL-12 B gene AA genotype presented more frequently in late stages of Hepatitis C virus chronically ill patients, while, CC genotype had no significant association with staging of liver disease and had low frequency especially in late stages of liver disease. PMID: 28595541
  5. Frequency of IL-12B AA (rs6871626) genotype was increased in Ankylosing Spondylitis patients. Interleukin IL-12B AA (rs6871626) gene polymorphisms could serve as promising biomarkers for diagnosis and prognosis in Ankylosing Spondylitis patients. PMID: 29200018
  6. The demonstrated allelic expression imbalance supports the idea that the IL12B risk haplotype confers susceptibility not only to Crohn's disease onset but to also relapse through increased IL12B mRNA expression. PMID: 28229296
  7. the present study IL-12B gene status was evaluated in 50 new sputum smear-positive pulmonary tuberculosis patients. PMID: 28697396
  8. The rs17860508 polymorphism in the IL12B promoter region may influence the risk of developing ovarian endometriosis by altering the endometrial expression of IL12B of in Northern Chinese women. PMID: 29738836
  9. The rs6871626 single nucleotide polymorphism in IL-12B is associated with the pathophysiology of Takayasu arteritis. PMID: 28874185
  10. Human neutrophil elastase is involved in transactivation of TLR4 through activation of DUOX-2/EGFR and synergistically enhances IL-12p40 production by macrophages stimulated with LPS. PMID: 27282560
  11. our results suggested a significant association between IL-12B 3'-UTR and rs6887695 SNPs and ADs. PMID: 27068848
  12. Single-nucleotide-polymorphisms of IL12B may be considered a high-risk factor for Takayasu arteritis in Chinese Han population PMID: 28160070
  13. IL-12B -1188 C allele may be a protective factor against asthma in East Asians PMID: 28287286
  14. The low expression of HDAC3 and overexpession of inflammatory cytokines (IL-18, IL-12 and TNF-alpha) in intrahepatic cholestasis of pregnancy may be involved in liver cell apoptosis and in the pathophysiology of the disease. PMID: 28697498
  15. Identification of PARP-1 as a unique regulator of Il12b transcription in response to inflammatory insults in an allele-differentiating manner PMID: 28219892
  16. Pre-incubation with IL-12 was able to restore IFN-gamma production and the cytotoxicity capacities of NK cells. This cytokine may therefore be considered as a potential treatment candidate in traumatic brain injury patients with immune suppression. PMID: 26387630
  17. Visceral leishmaniasis in two patients with IL-12p40 and IL-12Rbeta1 deficiencies PMID: 27873456
  18. NOD2 rs3135500 and IL12B rs1368439 SNPs were not genetic risk factors for colorectal cancer in the studied Iranian population. PMID: 27426943
  19. IL-12B gene polymorphisms were not related with rheumatoid arthritis (RA). However, rs6887695 was associated with RA in Asian patients PMID: 27155343
  20. Suggest Il12B SNPs as genetic marker of disease severity in Takayasu arteritis severity. PMID: 25783557
  21. The results of this study suggested that rs6887695 SNP in IL12B gene increase susceptibility to relapsing-remitting multiple sclerosis. PMID: 28276258
  22. these meta-analyses demonstrated that IL-12B rs3212227 and rs6887695 polymorphisms do not confer susceptibility to rheumatoid arthritis [data synthesis] PMID: 27312970
  23. Findings indicate that IL-12p40 + 1188A/C polymorphism as well as IL-12p70 protein levels may be associated with rheumatoid arthritis (RA) in the Polish population. PMID: 27896842
  24. The present meta-analysis suggests that the IL12B +1188A/C (rs3212227) polymorphism might be associated with genetic susceptibility to autoimmune diseases, such as type 1 diabetes, rheumatoid arthritis and Behcet disease, but not Graves disease and ankylosing spondylitis. PMID: 26915668
  25. this study shows that IL-12B gene polymorphism does not contribute to the risk of hepatocellular carcinoma on top of chronic hepatitis C virus infection in Egyptian patients PMID: 27819525
  26. this study has demonstrated (i) a significant association of -1082GG IL-10 genotype with susceptibility to autoimmune thyroid disease and (ii) the concomitant presence of IL-12B +1188CC and IL-10-1082 GG genotype contributes to the development and progression of Hashimoto's thyroiditis PMID: 27774749
  27. Il-12B SNPs have an association with anti-HBs Ab production after vaccination in healthy Korean infants. PMID: 28051794
  28. Our results reveal that the IL12A rs568408 variant may be a marker SNP for risk of both HBV clearance and HBV-related hepatocellular carcinoma development PMID: 26631030
  29. this study shows that the Il-12 genetic polymorphisms is associated with susceptibility to tuberculosis in patients and their household contacts in India PMID: 27108964
  30. High IL12 levels can inhibit Candida albicans colonizing the gastrointestinal tract of children and adolescents with diabetes mellitus type 1. PMID: 28127111
  31. this study shows that IL-12B gene polymorphism is genetic risk factor for systemic lupus erythematosus in the Polish population, and that it predicts disease phenotype PMID: 27059274
  32. analysis of cytokine gene polymorphisms suggests that IL-12 gene may play impact on specific pathogenesis of ophthalmopathy in Korean children with early onset autoimmune thyroid disease. PMID: 26850223
  33. IL-12 polymorphism rs3212227 might not be a critical risk factor for Preeclampsia in Chinese Han women. PMID: 27148908
  34. a tendency of a higher prevalence of the genotype IL-12p40 pro1.1 in systemic arthritis and in rheumatoid factor negative polyarthritis was observed but not significant PMID: 26667304
  35. genetic polymorphism is associated with psoriasis in the South Indian Tamils PMID: 26472011
  36. genetic polymorphism is associated with allergic rhinitis in Chinese patients PMID: 26663019
  37. The IL23R polymorphisms rs10889677, rs7517847, and the IL12B polymorphism rs3212227 are not associated with multiple sclerosis risk. PMID: 26000455
  38. IL-12 immunomodulation delays the onset of lethal peritoneal disease of ovarian cancer. PMID: 26430781
  39. variant IL-12p40 1188C/A genotype was AA (72.92%), AC (23.96%), and CC (3.13%%) in patients as compared to 65%, 30%, and 5%, respectively, in controls. PMID: 26516307
  40. the IL-12B rs3212227 AC and AC+CC genotypes are associated with rheumatoid arthritis risk in older patients,rheumatoid factor positive patients and anti-cyclic peptide antibodies negative patients PMID: 26375522
  41. High serum IL-12 levels associated with increased densities of peritumoral CD8(+) T cells, intraepithelial CD3(+) T cells and intratumoral neutrophils, while high serum CCL4 levels associated with increased densities of peritumoral CD68(+) cells PMID: 26874795
  42. These observations indicate a HDAC1-mediated IL-12B gene expression suppression by live, virulent Mycobacterium tuberculosis to subvert the immune system to survive and replicate in the host. PMID: 26697414
  43. IL-12p40 response to in vitro stimulation in patients with Mendelian susceptibility to mycobacterial disease was below normal levels. PMID: 25201764
  44. 8 SNPs (rs10045431, rs11167764, rs3212227, rs6556412, rs6556416, rs6871626, rs6887695 and rs7709212) were genotyped in Han ankylosing spondylitis patients and controls. rs6871626 may be associated AS susceptibility and activity. PMID: 26103568
  45. Replicating the association of single-nucleotide polymorphisms in the TNFAIP3, IL12B and IL23R genes with psoriasis vulgaris, in subjects from different ethnic backgrounds, underlines their importance in the pathogenesis of the disease. PMID: 25406098
  46. balance of IL-23 vs IL-12/IL-27 signals into CD4(+) effector T cells determines whether tissue inflammation is perpetuated or resolves PMID: 24796719
  47. Compared with the IL-12B-AA genotype, CC and combined CC/AC genotypes were associated with a significant decreased risk of Hepatitis C virus infection in Chinese hemodialysis patients. PMID: 25613737
  48. These results show that IL-15 and IL-12 combination has the ability to expand the selective depletion of invariant natural killer T cells in vitro in HIV-infected individuals. PMID: 24748538
  49. The risk of gastric cardiac adenocarcinoma associated with the IL12B rs3212227 T > G polymorphism was evident among Chinese female patients and Chinese patients who never smoked or consumed alcoholic drinks. PMID: 24529168
  50. Based on these results, we believe that the increased levels of IL-12p40 and IL-16 are associated with an ongoing inflammatory response in obese individuals and could lead to the development of disease conditions related to obesity. PMID: 25710036

Show More

Hide All

Involvement in disease
Immunodeficiency 29 (IMD29); Psoriasis 11 (PSORS11)
Subcellular Location
Secreted.
Protein Families
Type I cytokine receptor family, Type 3 subfamily
Database Links

HGNC: 5970

OMIM: 161561

KEGG: hsa:3593

STRING: 9606.ENSP00000231228

UniGene: Hs.674

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*