Recombinant Human Interleukin-13 receptor subunit alpha-1 (IL13RA1), partial

Code CSB-EP011591HU2
Abbreviation Recombinant Human IL13RA1 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Cancer/testis antigen 19
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
368-427aa
Target Protein Sequence
KRLKIIIFPPIPDPGKIFKEMFGDQNDDTLHWKKYDIYEKQTKEETDSVVLIENLKKASQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
13.2 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.144.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds with low affinity to interleukin-13 (IL13). Together with IL4RA can form a functional receptor for IL13. Also serves as an alternate accessory protein to the common cytokine receptor gamma chain for interleukin-4 (IL4) signaling, but cannot replace the function of IL2RG in allowing enhanced interleukin-2 (IL2) binding activity.
Gene References into Functions
  1. High IL13RA1 expression is associated with Invasive breast Cancer. PMID: 28634667
  2. in humans and mice indicate, for the first time, a role of interleukin-13 receptor alpha1 in myocardial homeostasis and heart failure and suggests a new therapeutic target to treat heart disease. PMID: 28528324
  3. sIL13ralpha1 as a circulating human protein with an unexpected role in glucose metabolism. PMID: 28874358
  4. IL-13Ralpha1 has a protective role in bleomycin-induced pulmonary injury and repair. PMID: 26153764
  5. required for induction of the alternative macrophage activation pathway by IL-13 but not by IL-4 PMID: 25766112
  6. Results identified FAM120A in the IL13/IL13Ralpha2 signaling pathway as a key mediator of invasion and liver metastasis in colon cancer. PMID: 25896327
  7. miR-143 regulation of IL-13-induced inflammatory cytokine and mucus production in nasal epithelial cells from allergic rhinitis patients probably partly depends on inhibition of IL13Ralpha1. PMID: 25529447
  8. MiR-143 may be associated with allergic reaction in human mast cells via downregulation of IL13RA1. PMID: 23965966
  9. In humans, IL-13Ralpha1 lies within the PARK12 locus of susceptibility to Parkinson's disease and may have a role in the pathogenesis of this neurodegenerative disease. PMID: 23169588
  10. These results indicate that an inherited polymorphism of the IL-4R controls the ability of the human immune system to regulate the magnitude of IL-17 production PMID: 21294892
  11. The IL-13R A(1) +1398 A/G polymorphism does not contribute to asthma or allergic rhinitis susceptibility. PMID: 21425907
  12. IL-13Ralpha1 is expressed on human CD4(+) T(H)17 cells PMID: 21236478
  13. Mutation and functional analysis in human malignant glioma cells PMID: 11939409
  14. IL4RA and STAT6 are candidate genes for atopic disorders. 26 single-nucleotide polymorphisms (SNPs)and simple repeats are being reported spanning a total of 147kb in IL4RA and STAT6 genes of the Indian population PMID: 12522691
  15. Allele frequency of IL13RA1 polymorphism was not associated with rapid decline of lung function in smokers. PMID: 12594065
  16. Overexpression of IL-13Ralpha1 may play some role in pathogenesis of chronic stage of atopic dermatitis or psoriasis. PMID: 14527737
  17. Bronchial submucosal mast cell IL-13 receptor alpha 1 expression is higher in asthmatics than normal controls. PMID: 16918506
  18. IL-13Ralpha1 polymorphism was associated with higher total IgE in children with atopic asthma PMID: 17006604
  19. the IL13RA1 subunit gene -281T>G and 1365A>G polymorphisms do not contribute to asthma susceptibility or severity, although the IL13RA1 subunit gene locus might be involved in the control of immunoglobulin E production PMID: 17392323
  20. concomitant expression of IL-13Ralpha1 and IL-13Ralpha2 may be associated with the pathogenesis of idiopathic interstitial pneumonia. PMID: 19654941

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
Type I cytokine receptor family, Type 5 subfamily
Tissue Specificity
Ubiquitous. Highest levels in heart, liver, skeletal muscle and ovary; lowest levels in brain, lung and kidney. Also found in B-cells, T-cells and endothelial cells.
Database Links

HGNC: 5974

OMIM: 300119

KEGG: hsa:3597

STRING: 9606.ENSP00000360730

UniGene: Hs.496646

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*