Recombinant Human Interleukin-3(IL3)

Code CSB-EP011652HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P08700
Relevance Granulocyte/macrophage colony-stimulating factors are cytokines that act in hatopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.This CSF induces granulocytes, macrophages, mast cells, st cells, erythroid cells, eosinophils and megakaryocytes.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Hematopoietic growth factorMast cell growth factor ;MCGFMultipotential colony-stimulating factorP-cell-stimulating factor
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Research Area Immunology
Source E.coli
Gene Names IL3
Expression Region 20-152aa
Tag Info N-terminal GST-tagged
Mol. Weight 42.1kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.; FUNCTION
Subcellular Location Secreted
Protein Families IL-3 family
Tissue Specificity Activated T-cells, mast cells, natural killer cells.
Database Links

HGNC: 6011

OMIM: 147740

KEGG: hsa:3562

STRING: 9606.ENSP00000296870

UniGene: Hs.694

Pathway Jak-STAT signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Fc epsilon RI signaling pathway
Hematopoietic cell lineage

Related Products

IL3 Antibodies

IL3 Antibodies for Homo sapiens (Human)

IL3 Antibodies for Human

IL3 Proteins

IL3 Proteins for Homo sapiens (Human)

IL3 ELISA Kit

IL3 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.