Recombinant Human Interleukin-3 (IL3) (Active)

In Stock
Code CSB-EP011652HUc7
Abbreviation Recombinant Human IL3 protein (Active)
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 5.972-17.16 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 5.972-17.16 ng/mL.
Target Names
Uniprot No.
Alternative Names
Interleukin-3; IL-3;Hematopoietic growth factor; Mast cell growth factor (MCGF); Multipotential colony-stimulating factor; P-cell-stimulating factor; IL3
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
20-152aa
Target Protein Sequence
APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Mol. Weight
22.0 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Interleukin-3 is a pleiotropic cytokine central to hematopoietic progenitor expansion and mast cell development, making precise recombinant forms essential for dissecting JAK/STAT and MAPK signaling downstream of the IL-3 receptor. This recombinant human IL-3 encompasses the full mature sequence (residues 20–152) with a C-terminal 6×His tag, expressed in *E. coli* and purified to greater than 95% purity by SDS-PAGE, providing a suitable basis for quantitative functional work. Validated bioactivity yields an ED50 of 5.97–17.16 ng/mL in TF-1 proliferation assays, confirming signaling potency appropriate for dose-response proliferation studies, hematopoietic differentiation experiments, and use as a reference standard in cytokine detection platforms. Endotoxin levels below 1.0 EU/μg satisfy the stringent criteria typical for immune cell assays—including PBMC activation and antibody validation by ELISA—where LPS contamination would otherwise confound cytokine-attributable readouts.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.; This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.
Gene References into Functions
  1. IL-3 may be involved in the immediate memory deficits in the chronic phase of schizophrenia. PMID: 29554544
  2. The present study demonstrates for the first time that IL-3 has an important role in enhancing the migration of human MSCs through regulation of the CXCR4/SDF-1alpha axis. These findings suggest a potential role of IL-3 in improving the efficacy of MSCs in regenerative cell therapy. PMID: 28705238
  3. These results indicate that IL-3 regulates endothelial cells-extracellular vesicles release, cargo and IL-3 angiogenic paracrine action via STAT5. PMID: 27157262
  4. T-GM-CSF and -IL-3 significantly, and reciprocally, blunted receptor binding and myeloid progenitor cell proliferation activity of both FL-GM-CSF and -IL-3 in vitro and in vivo PMID: 28344320
  5. Results show that IL-3 induces several signaling pathways associated with increased cell survival under oxidative stress. This activity correlates with previous fi ndings indicating glucose uptake stimulation by IL-3, which together contribute to an emerging picture of a broader mechanism promoting cell survival. PMID: 27862234
  6. The IL-3/ GM-CSF effected on the myofibroblastic differentiation of human adipose derive stromal cells (hASCs) as well as it did on human dermal fibroblasts (HDFs). PMID: 28377320
  7. Genetically engineered mesenchymal stromal cells produce IL-3 and TPO to further improve human scaffold-based xenograft models PMID: 28456746
  8. IL-3 hardly down-regulates the alpha-chain of its receptor without depleting the common beta-chain, which enables extraordinarily sustained signaling events, predominantly the activation of Stat5. PMID: 27443880
  9. genetic polymorphisms in the immune genes IL-3 rs181781 and CTLA4 rs4553808 may influence the TAC dose-adjusted concentrations PMID: 28112181
  10. Our results indicated that the IL-3 and IL-13 polymorphisms were not associated with rheumatoid arthritis (RA). stratification analyses suggested that the IL-13 rs1800925 CT and CT/CC genotypes increased the risk of RA in patients with erythrocyte sedimentation rate (ESR) <25.00. these findings suggest that the IL-13 rs1800925 C/T polymorphism may be associated with increased risk of RA in ESR PMID: 27323078
  11. results suggest that IL-3 and IL-12p40 could be considered as molecular predictors for recurrent wheezing due to RSV infection PMID: 26299549
  12. results suggest that IL3 is an important genetic regulator for human brain volume variation and implied that IL3 might have experienced weak or modest positive selection in the evolutionary history of humans PMID: 26875095
  13. Thymic stromal lymphopoietin activation of basophils in patients with allergic asthma is IL-3 dependent PMID: 25962901
  14. were not able to confirm the association of IL-3 SNPs with schizophrenia. PMID: 26277822
  15. findings showed that high plasma IL-3 levels are associated with high mortality in sepsis PMID: 25766237
  16. Genetic variation in interleukin-3 gene is associated with breast cancer risk. PMID: 24670917
  17. results suggest that HuR recognizes the ARE-rich region in the IL-3 3'-UTR and plays a role in the IL-3 3'-UTR-mediated post-transcriptional control in T-cells PMID: 24658545
  18. A single nucleotide polymorphism (SNP; rs20541) in the IL-13 gene has been recognized as a risk factor for asthma. PMID: 23978640
  19. This study is the first to link beta-catenin activation to IL-3 and suggests that targeting IL-3 signaling may be an effective approach for the inhibition of beta-catenin activity in some patients with AML. PMID: 24598054
  20. IL3 SNP rs40401 is significantly associated with the risk of asthma in young adult Japanese women. PMID: 24684517
  21. This is the first study to show a significant positive association between IL3 SNP rs40401 variant and the risk of rhinoconjunctivitis. PMID: 23953855
  22. IL3 rs2073506 G>A polymorphism is associated with an increased risk for esophageal cancer of nodal and metastatic stages. PMID: 23726808
  23. Genetic variation in the IL3 promoter affects human brain volume by regulating proliferation and survival of neural progenitors. PMID: 23226269
  24. Transgenic mice are used to study the developmental regulation of the closely linked IL-3 and granulocyte-macrophage colony stimulting factor (GM-CSF) locus and to identify DNA enhancer elements required for its correct activity in vivo. PMID: 23024272
  25. data indicate that within microenvironments rich in betac-family cytokines and TNF, eosinophils are a source of proMMP-9 and highlight a previously unrecognized role for synergistic interaction between TNF and betac-family cytokinea, for proMMP-9 synthesis PMID: 22321809
  26. This study demonistrated that Carriers of the minor allele for a single nucleotide polymorphism in IL13 (rs1295686) were more likely to report breast pain prior to surgery (P = .019). PMID: 22515947
  27. an IL-3 autocrine loop can drive a tumor endothelial switch and that targeting IL-3 might confer a significant therapeutic advantage to hamper tumor angiogenesis PMID: 21643009
  28. IL-3 provides cellular protection against amyloid-beta neurotoxicity in primary cortical neuronal cells and may play a neuroprotective role in Alzheimer's disease. PMID: 20964623
  29. The IL3 genotypes rs40401 and rs40401 were found to exert a protective effect against malaria attacks. PMID: 21224257
  30. Data indicate a role for PLCgamma2 and Ca(2+) signaling through the modulation of MEK/ERK in IL3/GM-csf stimulated human hematopoietic stem/progenitor cells. PMID: 21506110
  31. The interaction of 6-locus from the 5 interleukin genes might confer higher risk for graves'disease and Graves'ophthalmopathy than single risk allele. PMID: 20332709
  32. IL-3 genotypes of 60 acute rejection (AR) subjects and the 270 patients without AR demonstrated a significant relationship between genotype frequencies and the SNPs PMID: 21168724
  33. Human IL-3/GM-CSF knock-in mice support human alveolar macrophage development and human immune responses in the lung. PMID: 21262803
  34. propose that RhoH functions as a negative regulator for IL3-induced signals through modulation of the JAK-STAT pathway PMID: 20738848
  35. the domain 1 D-E loop disulfide of hbetac and beta(IL-3) in maintaining the precise positions of ligand-binding residues necessary for normal high affinity binding and signaling PMID: 20516062
  36. Two different modes of beta c binding are utilized in the presence of the hIL-3R alpha isoforms. PMID: 20472554
  37. a novel role for VPA in enhancing the potential of IL-3 to stimulate megakaryopoiesis as well as erythropoiesis PMID: 20381581
  38. The IL-3/GM-CSF locus undergoes progressive stages of activation, with stepwise increases in active modifications and the proportion of cytokine-expressing cells, throughout the course of T cell differentiation. PMID: 20147630
  39. IL-3 and oncogenic Abl regulate the myeloblast transcriptome by altering mRNA stability PMID: 19829692
  40. binding kinetics of native IL-3 and several variants to IL-3 receptor PMID: 11700046
  41. IL-3 induces MHC class II and B7.2 expression on eosinophils and renders them capable of supporting T cell proliferation to superantigen and antigen-derived peptides. PMID: 11714768
  42. inhibition of signaling by antisense oligodeoxynucleotides targeting the common beta chain of receptors PMID: 11763346
  43. ectopically expressed in myeloid leukemic cells with t(5;12)(q31;p13), suggesting that expression of IL3 was deregulated by the translocation, indicating a variant leukemogenic mechanism for translocations involving the 5' end of ETV6 PMID: 11861295
  44. Antiapoptotic cytokine IL-3 + SCF + FLT3L influence on proliferation of gamma-irradiated AC133+/CD34+ progenitor cells. PMID: 12002675
  45. Monocytes cultured in the presence of IL-3 (plus IL-4) differentiate into dendritic cells that produce less IL-12 and shift T helper (Th) cell responses toward a Th2 cytokine pattern. PMID: 12055233
  46. Data suggest that increased activity of mutated interleukin 3 is due to a change from a rare ligand to a common one, allowing the increase in IL-3-dependent signaling. PMID: 12093816
  47. role in potentiating hematopoietic cell migration PMID: 12135758
  48. The IL-3 gene is regulated by two enhancers that have distinct but overlapping tissue specificities. PMID: 12165512
  49. WEHI-3B-derived IL-3 stimulation of mcl-1 gene transcription through the SIE motif involves phosphorylation of PU.1 at serine 142 by a p38(MAPK)-dependent pathway. PMID: 12612065
  50. Incubation of eosinophils with IL-3 leads to reduced expression of IL-5R alpha which is sustained for up to 5 days; in contrast, expression of IL-3R alpha is increased by IL-3, whereas GM-CSF receptor alpha expression in eosinophils is unaffected by IL-3. PMID: 12759409

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
IL-3 family
Tissue Specificity
Activated T-cells, mast cells, natural killer cells.
Database Links

HGNC: 6011

OMIM: 147740

KEGG: hsa:3562

STRING: 9606.ENSP00000296870

UniGene: Hs.694

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*