Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 5.972-17.16 ng/mL.
Alternative Names
Interleukin-3; IL-3;Hematopoietic growth factor; Mast cell growth factor (MCGF); Multipotential colony-stimulating factor; P-cell-stimulating factor; IL3
Species
Homo sapiens (Human)
Expression Region
20-152aa
Target Protein Sequence
APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Inserting the gene encoding the Human IL3 protein (20-152aa) into a plasmid vector results in the creation of recombinant plasmid, which is introduced into e.coli cells. e.coli cells that can survive in the presence of a specific antibiotic are selected, indicating successful uptake of the recombinant plasmid. The e.coli cells containing the recombinant plasmid are cultured under conditions promoting the expression of the gene of interest. A C-terminal 6xHis tag is linked to the protein. After expression, affinity purification is used to isolate and purify the recombinant Human IL3 protein from the cell lysate. Denaturing SDS-PAGE is then applied to resolve the resulting recombinant Human IL3 protein, revealing a purity level exceeding 85%.