Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-AP004521HU |
| Product Type | Interleukin |
| Size |
US$137Purchase it in Cusabio online store (only available for customers from the US) |
| Uniprot No. | P08700 |
| Lead Time | 5-10 business days |
| Storage Buffer | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Alias | Interleukin-3; IL-3; Hematopoietic Growth Factor; Mast Cell Growth Factor; MCGF; Multipotential Colony-Stimulating Factor; P-Cell-Stimulating Factor; IL3 |
| Species | Homo sapiens (Human) |
| Biological_Activity | The ED50 as determined in a cell proliferation assay using TF?1 human erythroleukemic cells is less than 2 ng/ml. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Sequence | APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
| Research Area | Immunology |
| Source | Mammalian cell |
| Gene Names | IL3 |
| Expression Region | 20-152aa |
| Tag Info | C-terminal 6xHis-tagged |
| Mol. Weight | 16.1 kDa |
| Protein Description | Full Length of Mature Protein |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.; FUNCTION |
| Subcellular Location | Secreted |
| Protein Families | IL-3 family |
| Tissue Specificity | Activated T-cells, mast cells, natural killer cells. |
| Database Links |
HGNC: 6011 OMIM: 147740 KEGG: hsa:3562 STRING: 9606.ENSP00000296870 UniGene: Hs.694 |
| Pathway |
Jak-STAT signaling pathway
PI3K-Akt signaling pathway Apoptosis Fc epsilon RI signaling pathway Hematopoietic cell lineage |
IL3 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA011652GA01HU | IL3 Antibody | Human | ELISA,WB |
| CSB-PA06725D0Rb | IL3 Antibody, Biotin conjugated | Human | ELISA |
| CSB-PA06725C0Rb | IL3 Antibody, FITC conjugated | Human | ELISA |
| CSB-PA06725B0Rb | IL3 Antibody, HRP conjugated | Human | ELISA |
| CSB-PA196621 | IL3 Antibody | Human,Mouse | ELISA,WB |
IL3 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA06725A0Rb | IL3 Antibody | Human | ELISA, IHC |
| CSB-PA011652ESR1HU | IL3 Antibody | Human | ELISA, IHC |
IL3 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-AP004531HU | Recombinant Human Interleukin-3(IL3) | E.coli |
| CSB-YP011652HU CSB-BP011652HU CSB-MP011652HU |
Recombinant Human Interleukin-3(IL3) | Yeast Baculovirus Mammalian cell |
| CSB-EP011652HU | Recombinant Human Interleukin-3(IL3) | E.coli |
| CSB-EP011652HUc7 | Recombinant Human Interleukin-3(IL3) | E.coli |
| CSB-AP001701HU | Recombinant Human Interleukin-3 protein(IL3) (Active) | E.coli |
| CSB-AP005821HU | Recombinant Human Interleukin-3(IL3),partial (Active) (GMP) | E.Coli |
IL3 ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-E04631h | Human Interleukin 3,IL-3 ELISA KIT | serum, plasma | 0.78 pg/mL |
Recombinant Rat Dipeptidyl peptidase 4(Dpp4),partial
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Human N-acetylgalactosamine-6-sulfatase(GALNS)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Transcriptional enhancer factor TEF-1(TEAD1)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Mouse Hepatoma-derived growth factor(Hdgf)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Human E3 ubiquitin-protein ligase RBX1(RBX1)
Express system: E.coli
Species: Homo sapiens (Human)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.