Recombinant Human Intestinal-type alkaline phosphatase(ALPI)

Code CSB-YP001627HU
Product Type Recombinant Protein
Size US$2959
Uniprot No. P09923
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTTD
Research Area Signal Transduction
Source Yeast
Gene Names ALPI
Protein Names Recommended name: Intestinal-type alkaline phosphatase Short name= IAP Short name= Intestinal alkaline phosphatase EC= 3.1.3.1
Expression Region 20-503aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 54.4kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Lipid-anchor, GPI-anchor
Protein Families Alkaline phosphatase family
Database Links

HGNC: 437

OMIM: 171740

KEGG: hsa:248

STRING: 9606.ENSP00000295463

UniGene: Hs.284255

Related Products

ALPI Antibodies

ALPI Antibodies for Homo sapiens (Human)

ALPI Antibodies for Human

ALPI Proteins

ALPI Proteins for Homo sapiens (Human)

ALPI ELISA Kit

ALPI ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.