Recombinant Human Intestinal-type alkaline phosphatase (ALPI)

In Stock
Code CSB-EP001627HU
Abbreviation Recombinant Human ALPI protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
20-503aa
Target Protein Sequence
VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTTD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
58.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Intestinal-type alkaline phosphatase (ALPI) is produced in E.coli and includes the complete mature protein sequence from amino acids 20 to 503. The protein carries an N-terminal 6xHis-tag that makes purification and detection more straightforward. SDS-PAGE analysis confirms the purity exceeds 85%. This product is intended for research use only and maintains low endotoxin levels that appear suitable for various experimental work.

Intestinal-type alkaline phosphatase (ALPI) is an enzyme that primarily handles dephosphorylation processes in the gastrointestinal tract. It seems to play an important role in maintaining intestinal balance and acts as a key part of the body's defense against microbial invasion. ALPI is also being studied for its possible involvement in lipid absorption and detoxification pathways, which makes it an interesting target for gastrointestinal and enzyme research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Expression in E. coli does not guarantee proper folding or native post-translational modifications required for alkaline phosphatase activity, and there is no direct evidence of enzymatic activity or correct folding validated in the description. Therefore, it is uncertain whether the protein is correctly folded or biologically active without functional assays. The presence of a His-tag and bacterial expression could affect folding or activity, particularly for enzymes that rely on disulfide bonds or glycosylation, which are not typical of bacterial expression systems.

1. Biochemical Characterization and Enzyme Kinetics Studies

This recombinant ALPI protein allows researchers to examine basic biochemical properties of human intestinal-type alkaline phosphatase. Scientists can investigate substrate specificity, optimal pH and temperature conditions, and kinetic parameters. The N-terminal 6xHis tag facilitates purification and potential immobilization for enzymatic assays. Researchers may compare this recombinant enzyme's behavior with other alkaline phosphatase types to elucidate tissue-specific differences. The full-length mature protein (20-503aa) provides a model for studying the catalytic domain and any regulatory regions, provided that the protein is properly folded and active; if activity is not demonstrated, these studies should acknowledge potential folding limitations due to bacterial expression.

2. Antibody Development and Validation

The purified recombinant ALPI protein can serve as an antigen for generating antibodies against human intestinal-type alkaline phosphatase. The >85% purity and His-tag can aid in antibody development, with options for producing polyclonal and monoclonal antibodies. However, antibody specificity should be validated using orthogonal methods and, if possible, with native or properly folded antigen to ensure relevance. The recombinant protein can function as a positive control in antibody-based assays, contingent on verified antigenicity and conformation.

3. Protein-Protein Interaction Studies

The His-tagged recombinant ALPI can be employed in pull-down assays to identify interacting partners, using nickel-affinity matrices for capture. While this approach is feasible, the reliability of detected interactions depends on ALPI adopting a native-like conformation in the bacterial system. Co-immunoprecipitation with anti-His antibodies can help confirm interactions, but follow-up validation in more physiological systems is recommended.

4. Structural and Biophysical Analysis

The recombinant ALPI provides material for structural and biophysical studies if it is correctly folded and stable. Techniques such as X-ray crystallography or cryo-EM require homogeneous, native-like protein. If folding is uncertain, data interpretation should consider potential misfolding or non-native conformations arising from E. coli expression. Complementary analyses (DSC, CD, DLS) can inform on stability and folding status.

5. Inhibitor Screening and Drug Discovery Research

This recombinant ALPI can serve as a target for in vitro inhibitor screening, enabling standard assay development for preliminary inhibitor evaluation. The His-tag supports straightforward purification and assay setup. The suitability of hits for therapeutic development will depend on validating activity and physiological relevance in subsequent studies using a properly folded and active enzyme.

Final Recommendation & Action Plan

Proceed with a prioritized validation workflow: (1) confirm enzymatic activity under conditions typical for ALPI, (2) assess folding and stability using biophysical methods, (3) compare activity to known ALPI benchmarks and to ALPI from other tissues, and (4) validate antibody and interaction-based claims using both the recombinant protein and a secondary, more native-positive control. If activity or proper folding cannot be demonstrated, explicitly revise the application descriptions to reflect a non-validated, putative model, and consider alternative expression systems (eukaryotic or insect cells) or refolding protocols to achieve native-like conformation before proceeding with functional studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Alkaline phosphatase that can hydrolyze various phosphate compounds.
Gene References into Functions
  1. Data confirm that, in enterocytes (Caco-2 cells), 1-alpha,25-dihydroxy-vitamin-D3 up-regulates expression of 2 isoforms of IAP, alternative splicing variants. PMID: 28931466
  2. Expressions of human intestinal alkaline phosphatase and sucrase-isomaltase, which are intestinal differentiation markers, were highly enhanced in Caco-2 cells by menaquinone-4. PMID: 27865621
  3. Data indicate alkaline phosphatase (AP) as the primary soluble ectonucleotidase in infants undergoing cardiopulmonary bypass and show decreased capacity to clear AMP when AP activity decreases post-bypass. PMID: 27384524
  4. Intestinal alkaline phosphatase is a major regulator of gut mucosal permeability and appears to work at least partly through improving tight junction protein levels and localization. PMID: 27106638
  5. A High Level of Intestinal Alkaline Phosphatase Is Protective Against Type 2 Diabetes Mellitus Irrespective of Obesity PMID: 26844282
  6. Review of the role of intestinal alkaline phosphatase in inflammatory diseases. Loss of IAP expression or function is associated with increased intestinal inflammation, dysbiosis, bacterial translocation and subsequently systemic inflammation. PMID: 27083970
  7. The expression of ALPi and MUC5AC in cocultures of Caco-2 and HT29 cells developed for permeability studies is reported. PMID: 26299896
  8. Data indicate that histone deacetylase inhibitors (HDACi) induce intestinal alkaline phosphatase (ALPi) in a subset of colon cancer cell lines in a Kruppel-like factor 5 (KLF5)-dependent manner. PMID: 25037223
  9. Report lowered intestinal alkaline phosphatase in the colonic mucosa of children with inflammatory bowel disease. PMID: 22783049
  10. we are the first to demonstrate the alteration of protein expression of iAP in the duodenal mucosa of children with newly diagnosed coeliac disease PMID: 22262031
  11. Mechanism of IAP action appears to be through dephosphorylation of specific bacterial components, including LPS, CpG DNA, and flagellin, and not on live bacteria. IAP likely targets these bacterially derived molecules as gut mucosal defense factor. PMID: 20489044
  12. the structural differences in human AP isoforms are demonstrated through models PMID: 12372831
  13. intestinal alkaline transactivation by Kruppel-like factor-4 is likely mediated through a critical region located within the proximal IAP promoter region PMID: 12919939
  14. Northern blotting detected expression of two IAP transcripts, which were increased approximately 3-fold in response to thyroid hormone PMID: 15143152
  15. receptor for Aeromonas sobria hemolysin PMID: 15715171
  16. Cdx1 activates the IAP gene via a novel cis element, whereas Cdx2 inhibits the Cdx1 effects PMID: 15774940
  17. Cotransfection with an HNF-4alpha expression vector demonstrated a direct activation of the ALPI promoter through -94 to -82 element PMID: 15831710
  18. Crohn's disease increases the alkaline phosphatase activity in the intestine. Use histochemistry to differentiate Crohn's disease/ulcerative colitis. PMID: 17498884
  19. has the ability to detoxify lipopolysaccharide and prevent bacterial invasion across the gut mucosal barrier. IAP expression and function are lost with starvation and maintained by enteral feeding PMID: 18292227
  20. Cathepsin C propeptide interacts with intestinal alkaline phosphatase (IAP) and heat shock cognate protein 70. The propeptide of cathepsin C may stimulate the sorting to the lysosome contributing to the degradation of IAP in Caco-2 cells. PMID: 18307834
  21. Suggest role for lysophosphatidylcholine in brush-border intestinal alkaline phosphatase release and restoration. PMID: 19407215

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Protein Families
Alkaline phosphatase family
Database Links

HGNC: 437

OMIM: 171740

KEGG: hsa:248

STRING: 9606.ENSP00000295463

UniGene: Hs.284255

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*