Recombinant Human Intestinal-type alkaline phosphatase (ALPI), partial

In Stock
Code CSB-EP001627HU1
Abbreviation Recombinant Human ALPI protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Alkaline phosphatase intestinal; Alkaline phosphomonoesterase; Alpi; Glycerophosphatase; IAP; Intestinal alkaline phosphatase; Intestinal-type alkaline phosphatase; Kasahara isozyme; OTTHUMP00000164357; PPBI_HUMAN
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
26-500aa
Target Protein Sequence
ENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPAC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
55.5kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Intestinal-type alkaline phosphatase (ALPI) is produced in an E. coli expression system, covering amino acids 26 to 500. The protein carries an N-terminal 6xHis-tag for straightforward purification. It arrives with purity levels above 90%, as verified by SDS-PAGE analysis, which appears to support consistent performance in research applications. This product is designed strictly for research use and meets strict quality standards for endotoxin levels.

Intestinal-type alkaline phosphatase (ALPI) is an enzyme that's essential for dephosphorylation processes. It plays an important role in the digestive system by breaking down dietary phosphates. The enzyme participates in various physiological pathways, including nutrient absorption and gut barrier function. ALPI's activity seems vital for maintaining intestinal health and has become a subject of extensive research due to its regulatory roles in the human body.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Human ALPI is a complex eukaryotic enzyme that requires precise folding, disulfide bond formation, dimerization, and glycosylation for its functional phosphatase activity. The E. coli expression system cannot provide the necessary eukaryotic post-translational modifications, proper disulfide bonding, or glycosylation required for ALPI's native conformation and enzymatic function. While the protein may be soluble, it is highly unlikely to achieve the correct folding needed for functional phosphatase activity.

1. Antibody Development and Validation

This recombinant ALPI serves as an excellent immunogen for generating antibodies against linear epitopes of human intestinal alkaline phosphatase. The partial sequence (26-500aa) provides substantial epitope coverage. The His-tag facilitates purification and immunization procedures. However, antibodies may not efficiently recognize conformational epitopes on the native, properly folded ALPI.

2. Biochemical Characterization

Basic biophysical characterization (SEC, CD spectroscopy) can assess physical properties, which provide critical data about the protein itself, not the native, properly folded ALPI.

3. Comparative Structural and Functional Studies

This protein can be used for sequence-based comparisons and immunological cross-reactivity studies with other alkaline phosphatase isoforms. However, comparative functional analyses would be invalid due to the protein's misfolded state. Structural comparisons via Western blotting are feasible, but functional comparisons are not.

Final Recommendation & Action Plan

The E. coli expression system is fundamentally unsuitable for producing a functional version of this complex eukaryotic enzyme, limiting applications to non-functional uses. The immediate priority is basic biophysical characterization to assess the protein's physical properties through SEC and CD spectroscopy. Application 1 (Antibody Development) can proceed immediately for generating linear epitope antibodies. Functional studies must be avoided due to the high probability of misfolding. For functional ALPI studies, alternative approaches using eukaryotic expression systems (e.g., mammalian or insect cells) that support proper disulfide bond formation, glycosylation, and dimerization are essential. 

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Alkaline phosphatase that can hydrolyze various phosphate compounds.
Gene References into Functions
  1. Data confirm that, in enterocytes (Caco-2 cells), 1-alpha,25-dihydroxy-vitamin-D3 up-regulates expression of 2 isoforms of IAP, alternative splicing variants. PMID: 28931466
  2. Expressions of human intestinal alkaline phosphatase and sucrase-isomaltase, which are intestinal differentiation markers, were highly enhanced in Caco-2 cells by menaquinone-4. PMID: 27865621
  3. Data indicate alkaline phosphatase (AP) as the primary soluble ectonucleotidase in infants undergoing cardiopulmonary bypass and show decreased capacity to clear AMP when AP activity decreases post-bypass. PMID: 27384524
  4. Intestinal alkaline phosphatase is a major regulator of gut mucosal permeability and appears to work at least partly through improving tight junction protein levels and localization. PMID: 27106638
  5. A High Level of Intestinal Alkaline Phosphatase Is Protective Against Type 2 Diabetes Mellitus Irrespective of Obesity PMID: 26844282
  6. Review of the role of intestinal alkaline phosphatase in inflammatory diseases. Loss of IAP expression or function is associated with increased intestinal inflammation, dysbiosis, bacterial translocation and subsequently systemic inflammation. PMID: 27083970
  7. The expression of ALPi and MUC5AC in cocultures of Caco-2 and HT29 cells developed for permeability studies is reported. PMID: 26299896
  8. Data indicate that histone deacetylase inhibitors (HDACi) induce intestinal alkaline phosphatase (ALPi) in a subset of colon cancer cell lines in a Kruppel-like factor 5 (KLF5)-dependent manner. PMID: 25037223
  9. Report lowered intestinal alkaline phosphatase in the colonic mucosa of children with inflammatory bowel disease. PMID: 22783049
  10. we are the first to demonstrate the alteration of protein expression of iAP in the duodenal mucosa of children with newly diagnosed coeliac disease PMID: 22262031
  11. Mechanism of IAP action appears to be through dephosphorylation of specific bacterial components, including LPS, CpG DNA, and flagellin, and not on live bacteria. IAP likely targets these bacterially derived molecules as gut mucosal defense factor. PMID: 20489044
  12. the structural differences in human AP isoforms are demonstrated through models PMID: 12372831
  13. intestinal alkaline transactivation by Kruppel-like factor-4 is likely mediated through a critical region located within the proximal IAP promoter region PMID: 12919939
  14. Northern blotting detected expression of two IAP transcripts, which were increased approximately 3-fold in response to thyroid hormone PMID: 15143152
  15. receptor for Aeromonas sobria hemolysin PMID: 15715171
  16. Cdx1 activates the IAP gene via a novel cis element, whereas Cdx2 inhibits the Cdx1 effects PMID: 15774940
  17. Cotransfection with an HNF-4alpha expression vector demonstrated a direct activation of the ALPI promoter through -94 to -82 element PMID: 15831710
  18. Crohn's disease increases the alkaline phosphatase activity in the intestine. Use histochemistry to differentiate Crohn's disease/ulcerative colitis. PMID: 17498884
  19. has the ability to detoxify lipopolysaccharide and prevent bacterial invasion across the gut mucosal barrier. IAP expression and function are lost with starvation and maintained by enteral feeding PMID: 18292227
  20. Cathepsin C propeptide interacts with intestinal alkaline phosphatase (IAP) and heat shock cognate protein 70. The propeptide of cathepsin C may stimulate the sorting to the lysosome contributing to the degradation of IAP in Caco-2 cells. PMID: 18307834
  21. Suggest role for lysophosphatidylcholine in brush-border intestinal alkaline phosphatase release and restoration. PMID: 19407215

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Protein Families
Alkaline phosphatase family
Database Links

HGNC: 437

OMIM: 171740

KEGG: hsa:248

STRING: 9606.ENSP00000295463

UniGene: Hs.284255

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*