Name: Recombinant Human Ly6/PLAUR domain-containing protein 3(LYPD3)
Brand: CUSABIO
SKU: CSB-EP013263HU

Product Details

Purity	Greater than 85% as determined by SDS-PAGE.
Target Names	LYPD3
Uniprot No.	O95274
Research Area	Cancer
Alternative Names	GPI-anchored metastasis-associated protein C4.4A homolog (Matrigel-induced gene C4 protein) (MIG-C4)
Species	Homo sapiens (Human)
Source	E.coli
Expression Region	31-326aa
Target Protein Sequence	LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRLTGGAAGHQDRSNSGQYPAKGGPQQPHNKGC Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight	37.1 kDa
Protein Length	Full Length of Mature Protein
Tag Info	N-terminal 10xHis-tagged
Form	Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	3-7 business days
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Target Background

Function (From Uniprot)	Supports cell migration. May be involved in urothelial cell-matrix interactions. May be involved in tumor progression.
Gene References into Functions	While in the healthy liver hepatocytes are C4.4A negative, data show that C4.4A is strongly expressed in hepatocellular carcinoma (HCC) with upregulation at the invasive front and in lung metastasis, indicating that C4.4A apparently contributes to HCC progression. PMID: 29048672 Our results are consistent with previous data in mouse embryogenesis and wound healing. Based on these findings, we conclude that this human TES model provides an excellent surrogate for studies of C4.4A and Haldisin expressions in human stratified epithelia. PMID: 29075641 Expression and crystallographic studies of the D1D2 domains of C4.4A have been reported. PMID: 28777093 LYPD3 has a role in the maintenance of colorectal cancer stem-like cells. PMID: 28238780 Highly expressed C4.4A protein in HER2-positive human breast cancers indicate a good prognosis. PMID: 23918676 overexpression of C4.4A correlates with metastatic potential of gastric cancer and C4.4A could be a novel independent prognostic marker for predicting outcome. PMID: 24935570 expression of the Ly6/uPAR-domain proteins C4.4A and Haldisin in non-invasive and invasive skin lesions PMID: 25414274 Tenascin-C expression was significantly associated with C4.4A expression in clinical esophageal squamous carcinoma samples suggesting that there may be a functional role for the C4.4A to induceTenascin-C in vivo. PMID: 23708783 findings suggest that a tight association between C4.4A and tumor budding may, in part, be due to C4.4A promoting epithelial-mesenchymal transition at the invasive front of colorectal cancer PMID: 22404718 the first explanation for the C4.4A contribution to wound healing and metastasis. PMID: 22431918 data indicate that expression of the C4.4A protein at the invasive front acts as a novel prognostic marker in colorectal cancer, possibly through invasion-related mechanisms PMID: 20825414 hAG-2 and hAG-3, human homologues of genes involved in differentiation, are associated with oestrogen receptor-positive breast tumours and interact with metastasis gene C4.4a and dystroglycan PMID: 12592373 High tumour cell C4.4A expression is associated with shorter survival for non-small cell lung cancer patients. PMID: 17706320 Overexpression of C4.4A is associated with invasion and metastasis of esophageal squamous cell carcinoma PMID: 17849475 we consider C4.4A as a candidate diagnostic marker in colorectal cancer, which possibly can be detected in body fluids PMID: 17912244 cleavage of C4.4A by ADAM10 and ADAM17 contributes to tumor progression PMID: 18979631 Show More Hide All
Subcellular Location	Cell membrane; Lipid-anchor, GPI-anchor.
Tissue Specificity	Expressed in placenta, skin and urothelium. Found in suprabasal keratinocytes of chronic wounds. Weak expression is found in esophagus and peripheral blood mononuclear cells. Found in the majority of primary and metastatic transitional cell carcinomas (TC
Database Links	HGNC: 24880 OMIM: 609484 KEGG: hsa:27076 STRING: 9606.ENSP00000244333 UniGene: Hs.631594

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-EP013263HU
Size	$2062
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Ly6/PLAUR domain-containing protein 3(LYPD3)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

CloseMessage

×CloseMessage