Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
GPI-anchored metastasis-associated protein C4.4A homolog (Matrigel-induced gene C4 protein) (MIG-C4)
Species
Homo sapiens (Human)
Expression Region
31-326aa
Target Protein Sequence
LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRLTGGAAGHQDRSNSGQYPAKGGPQQPHNKGC
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Optimize your cancer research endeavors with our superior-quality Recombinant Human LYPD3 protein. Ly6/PLAUR domain-containing protein 3 (LYPD3), also known as C4.4A, has been implicated in various cancer types due to its involvement in cell migration, adhesion, and metastasis. The study of this protein holds potential in uncovering novel cancer therapeutics and understanding the underlying mechanisms of tumor progression.
Our Recombinant Human LYPD3 protein has been expertly produced in E. coli to ensure a dependable and consistent expression system. Covering the full length of the mature protein (31-326 amino acids), this recombinant protein has been meticulously designed to maintain the structural and functional integrity of the native LYPD3. The N-terminal 10xHis-tag enables streamlined purification while preserving the protein's bioactivity. With a purity of greater than 85% as determined by SDS-PAGE, our Recombinant Human LYPD3 protein is the ideal choice to elevate your cancer research endeavors. Choose our high-quality protein for accurate and reliable insights into the role of LYPD3 in cancer development and progression.
