| Code | CSB-EP013263HU |
| Size | $2062 |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
| Description |
Like all recombinant proteins, this Recombinant Human LYPD3 protein was encoded by recombinant DNA. The recombinant DNA was introduced to a plasmid in which the gene of LYPD3 was cloned downstream of a promoter region. When the plasmid was introduced to the cells of E.coli, the E.coli’s own protein synthesis pathways would then result in the expression of the LYPD3 protein. And the next step was protein purification. The purity of this recombinant protein is 85%+ determined by SDS-PAGE. LYPD3 is a tumorigenesis and metastasis-associated cell surface protein that was found to be expressed in 50% of primary lung cancers and metastases on the transcriptional level. Meanwhile, the expression of LYPD3 is found to be upregulated in some of NSCLC subtypes such as squamous cell lung cancer. . Research on the correlation between LYPD3 and the occurrence of cancer has garnered increasing scientific attention. Studies have shown that LYPD3 can specifically participate in tumor cell invasion through its interaction with extracellular matrix. Moreover, the antibody–drug conjugate targeting LYPD3 has shown efficacy in mouse models of lung cancer. In addition, cases with hypermethylated LYPD3 have better prognosis and survival status, which confirms our conjecture. There is evidence that LYPD3 can promote the epithelial–mesenchymal transition (EMT) in the aggressive front of tumor tissues, which would lead to initiation and development of cancers and chemo-resistance of metastatic cancers. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Target Names | LYPD3 |
| Uniprot No. | O95274 |
| Research Area | Cancer |
| Alternative Names | GPI-anchored metastasis-associated protein C4.4A homolog (Matrigel-induced gene C4 protein) (MIG-C4) |
| Species | Homo sapiens (Human) |
| Source | E.coli |
| Expression Region | 31-326aa |
| Target Protein Sequence | LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRLTGGAAGHQDRSNSGQYPAKGGPQQPHNKGC Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 37.1 kDa |
| Protein Length | Full Length of Mature Protein |
| Tag Info |
N-terminal 10xHis-tagged |
| Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | 3-7 business days |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
| Function |
Supports cell migration. May be involved in urothelial cell-matrix interactions. May be involved in tumor progression.
|
| Gene References into Functions |
|
| Subcellular Location | Cell membrane; Lipid-anchor, GPI-anchor. |
| Tissue Specificity | Expressed in placenta, skin and urothelium. Found in suprabasal keratinocytes of chronic wounds. Weak expression is found in esophagus and peripheral blood mononuclear cells. Found in the majority of primary and metastatic transitional cell carcinomas (TC |
| Database Links |
HGNC: 24880 OMIM: 609484 KEGG: hsa:27076 STRING: 9606.ENSP00000244333 UniGene: Hs.631594 |
