Recombinant Human Ly6/PLAUR domain-containing protein 3(LYPD3)

Code CSB-EP013263HU
Size US$2062
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Target Names LYPD3
Uniprot No. O95274
Research Area Cancer
Alternative Names 2310061G07Rik; C4.4A; GPI-anchored metastasis-associated protein C4.4A homolog; GPI-anchored metastasis-associated protein homolog; Ly6/PLAUR domain-containing protein 3; Lypd3; LYPD3_HUMAN; Matrigel-induced gene C4 protein; MIG-C4; SHINC3
Species Homo sapiens (Human)
Source E.coli
Expression Region 31-326aa
Target Protein Sequence LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRLTGGAAGHQDRSNSGQYPAKGGPQQPHNKGC
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 37.1 kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 10xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function Supports cell migration. May be involved in urothelial cell-matrix interactions. May be involved in tumor progression.
Gene References into Functions
  1. While in the healthy liver hepatocytes are C4.4A negative, data show that C4.4A is strongly expressed in hepatocellular carcinoma (HCC) with upregulation at the invasive front and in lung metastasis, indicating that C4.4A apparently contributes to HCC progression. PMID: 29048672
  2. Our results are consistent with previous data in mouse embryogenesis and wound healing. Based on these findings, we conclude that this human TES model provides an excellent surrogate for studies of C4.4A and Haldisin expressions in human stratified epithelia. PMID: 29075641
  3. Expression and crystallographic studies of the D1D2 domains of C4.4A have been reported. PMID: 28777093
  4. LYPD3 has a role in the maintenance of colorectal cancer stem-like cells. PMID: 28238780
  5. Highly expressed C4.4A protein in HER2-positive human breast cancers indicate a good prognosis. PMID: 23918676
  6. overexpression of C4.4A correlates with metastatic potential of gastric cancer and C4.4A could be a novel independent prognostic marker for predicting outcome. PMID: 24935570
  7. expression of the Ly6/uPAR-domain proteins C4.4A and Haldisin in non-invasive and invasive skin lesions PMID: 25414274
  8. Tenascin-C expression was significantly associated with C4.4A expression in clinical esophageal squamous carcinoma samples suggesting that there may be a functional role for the C4.4A to induceTenascin-C in vivo. PMID: 23708783
  9. findings suggest that a tight association between C4.4A and tumor budding may, in part, be due to C4.4A promoting epithelial-mesenchymal transition at the invasive front of colorectal cancer PMID: 22404718
  10. the first explanation for the C4.4A contribution to wound healing and metastasis. PMID: 22431918
  11. data indicate that expression of the C4.4A protein at the invasive front acts as a novel prognostic marker in colorectal cancer, possibly through invasion-related mechanisms PMID: 20825414
  12. hAG-2 and hAG-3, human homologues of genes involved in differentiation, are associated with oestrogen receptor-positive breast tumours and interact with metastasis gene C4.4a and dystroglycan PMID: 12592373
  13. High tumour cell C4.4A expression is associated with shorter survival for non-small cell lung cancer patients. PMID: 17706320
  14. Overexpression of C4.4A is associated with invasion and metastasis of esophageal squamous cell carcinoma PMID: 17849475
  15. we consider C4.4A as a candidate diagnostic marker in colorectal cancer, which possibly can be detected in body fluids PMID: 17912244
  16. cleavage of C4.4A by ADAM10 and ADAM17 contributes to tumor progression PMID: 18979631

Show More

Hide All

Subcellular Location Cell membrane, Lipid-anchor, GPI-anchor
Tissue Specificity Expressed in placenta, skin and urothelium. Found in suprabasal keratinocytes of chronic wounds. Weak expression is found in esophagus and peripheral blood mononuclear cells. Found in the majority of primary and metastatic transitional cell carcinomas (TC
Database Links

HGNC: 24880

OMIM: 609484

KEGG: hsa:27076

STRING: 9606.ENSP00000244333

UniGene: Hs.631594

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1