Recombinant Human Oncostatin-M(OSM),partial

Code CSB-YP017260HUc7
Product Type Recombinant Protein
Size US$2959
Uniprot No. P13725
Relevance Growth regulator. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (heterodimers composed of LIPR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSR
Research Area Immunology
Source Yeast
Gene Names OSM
Expression Region 26-220aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 24.0 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Growth regulator. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (heterodimers composed of LIPR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration (By similarity).
Subcellular Location Secreted
Protein Families LIF/OSM family
Database Links

HGNC: 8506

OMIM: 165095

KEGG: hsa:5008

STRING: 9606.ENSP00000215781

UniGene: Hs.248156

Pathway Jak-STAT signaling pathway
PI3K-Akt signaling pathway

Related Products

OSM Antibodies

OSM Antibodies for Human

OSM Antibodies for Homo sapiens (Human)

OSM Proteins

OSM Proteins for Homo sapiens (Human)

OSM ELISA Kit

OSM ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.