Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human OSM at 2 μg/mL can bind Anti-OSM recombinant antibody (CSB-RA017260MA1HU), the EC50 is 3.048-3.860 ng/mL.
Species
Homo sapiens (Human)
Expression Region
26-221aa
Target Protein Sequence
AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR
Tag Info
C-terminal 6xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Recombinant human OSM is synthesized using a mammalian cell expression system. The gene segment encoding human OSM (26-221aa) is linked with a 6xHis-tag gene at the C-terminus, then inserted into a plasmid vector. This recombinant vector is introduced into mammalian cells, which are cultured to prompt protein generation. The yielded recombinant human OSM protein is confirmed to be over 95% pure by SDS-PAGE, with endotoxin levels below 1.0 EU/ug via the LAL method. Its functional validation involves interactions with OSM recombinant antibody (CSB-RA017260MA1HU), with the EC50 of 3.048-3.860 ng/mL.
OSM belongs to the IL-6 family of secreted protein factors and plays a crucial role in maintaining the homeostasis of the body's environment under conditions of chronic inflammation. It exerts multifunctional regulatory effects in cellular proliferation, differentiation, hematopoietic system function, and inflammatory immunity in pathological and physiological processes. OSM acts as a pro-inflammatory or anti-inflammatory agent by inducing or inhibiting pro-inflammatory cytokines and chemokines during the inflammatory cycle. Higher concentrations of OSM have been detected in synovial fluid from rheumatoid arthritis patients. OSM has the potential to significantly induce joint damage and trigger inflammatory arthritis. OSM is closely related to inflammatory bowel disease (IBD). Increased expression of OSM in myocardial cells plays a protective role in the cardiovascular system. Therefore, OSM could be a potential therapeutic target for these diseases. Consequently, preparing active OSM protein can aid in clinical drug development and research related to OSM.
