Home
Active Protein
Other
Recombinant Human Oncostatin-M (OSM), partial (Active)

Recombinant Human Oncostatin-M (OSM), partial (Active)

^{In Stock}

Code	CSB-MP017260HU1
Abbreviation	Recombinant Human OSM protein, partial (Active)
MSDS	MSDS Datasheet
Size	$136
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human OSM at 2μg/mL can bind Anti-OSM recombinant antibody (CSB-RA017260MA1HU)，the EC₅₀ is 3.048-3.860 ng/mL. Biological Activity Assay OSM Recombinant Monoclonal Antibody (CSB-RA017260MA1HU) captured on Protein A Chip can bind Recombinant Human OSM protein with an affinity constant of 0.59 nM as detected by MetaSPR Assay (WeSPRTM 200).
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human OSM at 2 μg/mL can bind Anti-OSM recombinant antibody (CSB-RA017260MA1HU), the EC50 is 3.048-3.860 ng/mL.

Target Names

OSM

Uniprot No.

P13725

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

26-221aa

Target Protein Sequence

AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR

Mol. Weight

24.4 kDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Oncostatin-M plays a pivotal role in JAK/STAT3 and MAPK signaling cascades that govern immune cell differentiation, inflammatory responses, and tissue remodeling. This recombinant human OSM, spanning residues 26–221 with a C-terminal 6xHis tag, is expressed in mammalian cells to preserve native folding and post-translational modifications critical for receptor engagement. Functional ELISA confirms robust binding activity, with immobilized OSM at 2 μg/mL engaging an anti-OSM recombinant antibody at an EC₅₀ of 3.048–3.860 ng/mL, supporting use as a coating antigen for antibody development, an ELISA positive control, or a reference standard in cytokine detection assays. Endotoxin levels below 1.0 EU/μg minimize LPS-driven artifacts in sensitive immune cell assays such as TF-1 proliferation, STAT3 phosphorylation studies, and macrophage activation experiments, while purity exceeding 95% by SDS-PAGE provides a suitable basis for quantitative signaling pathway analyses and in vivo inflammation models.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Growth regulator. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (heterodimers composed of LIFR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration.

Gene References into Functions

The mechanism of prostaglandin E2-induced transcriptional up-regulation of Oncostatin-M by CREB and Sp1 has been described. PMID: 29269396
OSM [oncostatin M]might be involved in the invasiveness of extravillous trophoblasts under hypoxia conditions via increasing MMP-2 and MMP-9 enzymatic activities through STAT3 signaling. Increased MMP-9 activity by OSM seems to be more important in primary trophoblasts. PMID: 30091322
IL6 family cytokine oncostatin-M (OSM) induced a switch to the EMT phenotype and protected cells from targeted drug-induced apoptosis in OSM receptors (OSMRs)/JAK1/STAT3-dependent manner PMID: 28729401
Oncostatin M induces RIG-I and MDA5 expression and enhances the double-stranded RNA response in fibroblasts. PMID: 28560754
The IL-6-type cytokine oncostatin M (OSM) indeed induces cellular properties associated with tumorigenesis and disease progression in non-transformed human prostate epithelial cells, including morphological changes, epithelial-to-mesenchymal transition (EMT), enhanced migration and pro-invasive growth patterns. PMID: 29526757
downregulation of miR-20a-5p is caused by promoter hypermethylation. MiR-20a-5p could also suppress the production of IL-17 by targeting OSM and CCL1 production in CD4(+) T cells in patients with active VKH. PMID: 28972028
our findings suggested that OSM suppresses SLUG expression and tumor metastasis of lung adenocarcinoma cells through inducing the inhibitory effect of the STAT1-dependent pathway and suppressing the activating effect of STAT3-dependent signaling PMID: 27486982
Genistein (a specific Tyr phosphorylation inhibitor) leads to the interaction of CHOP (C/EBP Homologous Protein) with C/EBP-beta, thus negatively regulating it. Knockdown of C/EBP-beta also leads to inhibition of PMA-mediated OSM induction. PMID: 27676154
Data provide evidence that OSM regulates an epithelial-mesenchymal transition and cancer stem cell plasticity program that promotes tumorigenic properties in pancreatic cells. PMID: 28053127
OSM-induced plasticity was Signal Transducer and Activator of Transcription 3 (STAT3)-dependent, and also required a novel intersection with transforming growth factor-beta (TGF-beta)/SMAD signaling. Removal of OSM or inhibition of STAT3 or SMAD3 resulted in a marked reversion to a non-invasive, epithelial phenotype. PMID: 28288136
Neutrophils are a major source of OSM-producing cells in patients with chronic rhinosinusitis and severe asthma. PMID: 27993536
OSM and OSMR are highly expressed in inflammatory bowel disease intestinal mucosa compared to control mucosa. OSM promotes inflammatory behavior in human intestinal stroma. PMID: 28368383
Study showed that in atrial fibrillation (AF) with thrombus, the atrial tissue infiltration of M1 macrophages increased significantly; the OSM expression was also found to increase simultaneously; downstream tissue factor (TF) increased and tissue factor pathway inhibitors (TFPI)decreased, leading to an imbalance between TF and TFPI eventually. OSM might be related to thrombosis in patients with AF mediated by TF and TFPI PMID: 28471981
a novel STAT3/SMAD3-signaling axis is required for OSM-mediated senescence. PMID: 27892764
This result demonstrates that HPV16 oncoproteins upregulate oncostatin M and play an important role to promote oral squamous cell carcinoma development PMID: 27349249
The identification of the OSM inflammatory pathway as an important mediator of epithelial mesenchymal transition in triple-negative breast cancer (TNBC) may provide a novel potential opportunity to improve therapeutic strategies. PMID: 28106823
Oncostatin M and interleukin-31: Cytokines, receptors, signal transduction and physiology. PMID: 26198770
Oncostatin M can regulate airway smooth muscle responses alone or in synergy with IL-17A. PMID: 25849622
we demonstrated that recombinant human OSM (rhOSM) promoted tumor angiogenesis in EC cell lines by activating STAT3 (signal transducer and activator of transcription 3) and enhanced both cell migration and cell inva PMID: 25954856
OSM expression in osteoblasts increases in response to Osteopontin-induced inflammation in vitro. PMID: 26304992
Data suggest that OSM promotes osteoblastic differentiation of vascular smooth muscle cells through JAK3/STAT3 pathway and may contribute to the development of atherosclerotic calcification. PMID: 25735629
administration of Fstl1 induced airway remodeling and increased OSM, whereas administration of an anti-OSM Ab blocked the effect of Fstl1 on inducing airway remodeling, eosinophilic airway inflammation PMID: 26355153
OSM promotes mucosal epithelial barrier dysfunction, and its expression is increased in patients with eosinophilic mucosal disease. PMID: 25840724
Oncostatin M regulates neuronal function and confers neuroprotectin in an animal model of ischemic stroke. PMID: 26311783
In patients with diabetes, bone marrow plasma OSM levels were higher and correlated with the bone marrow to peripheral blood stem cell ratio. PMID: 25804939
OSM promotes STAT3-dependent intestinal epithelial cell proliferation and wound healing in vitro. PMID: 24710357
Autocrine activation of STAT3 in MCF-7 cells ectopically expressing OSM-induced cellular scattering. PMID: 25252914
oncostatin M is a cytokine possessing vigorous antiviral and immunostimulatory properties which is released by APC upon interaction with CD40L present on activated CD4+ T cells. PMID: 24418171
Data indicate that pro-inflammatory cytokines such as IL6 or OSM could activate pathways associated with prostate cancer progression and synergize with cell-autonomous oncogenic events to promote aggressive malignancy. PMID: 23867565
OSM may promote a clinically relevant EMT/CSC-like phenotype in human breast cancer via a PI3K-dependent mechanism PMID: 23584474
white adipose tissue macrophages are a source of OSM and OSM levels are significantly induced in obesity/type 2 diabetes. OSM produced from immune cells in WAT may act in a paracrine manner on adipocytes to promote inflammation in adipose tissue. PMID: 24297795
data suggest that increased serum OSM levels are associated with the coronary stenosis score and that circulating levels of this chemokine may reflect the extent of coronary atherosclerosis PMID: 24600984
TGFBI and periostin, extracellular matrix proteins implicated in tumorigenesis and metastasis, were identified as oncostatin M-induced secreted proteins in mesenchymal stem cells. PMID: 23735324
Oncostatin M is a FIP1L1/PDGFRA-dependent mediator of cytokine production in chronic eosinophilic leukemia. PMID: 23621172
These data show that OSM and IL-1beta are not only a biological characteristic signature of hypertensive leg ulcer, but these cytokines reflect a specific inflammatory state, directly involved in the pathogenesis. PMID: 23313749
OSM induced proliferation of Ewing sarcoma cell lines. PMID: 22982441
Data suggest that OSM enhances invasion activities of extravillous trophoblasts during placentation through increased enzyme activity of MMP-2 (primarily) and MMP-9 (to some extent). PMID: 22931588
A unique loop structure in oncostatin M determines binding affinity toward oncostatin M receptor and leukemia inhibitory factor receptor. PMID: 22829597
Oncostatin M signaling may cause suppression of estrogen receptor-alpha and disease progression i breast cancer. PMID: 22267707
Oncostatin M (OSM), a cytokine of the IL-6 family, was identified as a major coupling factor produced by activated circulating CD14+ or bone marrow CD11b+ monocytes/macrophages. PMID: 22267310
Oncostatin M (OSM) is a major mediator of cardiomyocyte dedifferentiation and remodeling during acute myocardial infarction (MI) and in chronic dilated cardiomyopathy (DCM). PMID: 22056139
JAK2 V617F-mediated up-regulation of OSM may contribute to fibrosis, neoangiogenesis, and the cytokine storm observed in myeloproliferative neoplasms. PMID: 22051730
c-MYC is an important molecular switch that alters the cellular response to OSM-mediated signaling from tumor suppressive to tumor promoting. PMID: 21975934
A possible interaction between IL-6, OSM, u-PA and VEGF in prostate cancer was investigated. PMID: 21965736
This report uses an in vitro model with human umbilical vein endothelial cells and isolated human neutrophils to examine the effects of two locally derived cytokines, granulocyte-macrophage colony-stimulating factor and G-CSF, on oncostatin M expression. PMID: 21775705
OSM is expressed in atherosclerotic lesions and may contribute to the progression of atherosclerosis by promoting SMC proliferation, migration and extracellular matrix protein synthesis through the STAT pathway PMID: 21376322
Taken together, our data show that KIT D816V promotes expression of OSM through activation of STAT5. PMID: 21457934
The purpose of this study was to investigate the possible suppressive or stimulatory role of OSM in the ovarian cancer model of SKOV3 cells, as well as the involvement of the ERK1/2, p38 and STAT3 signaling pathways. PMID: 21399864
promotes STAT3 activation, VEGF production, and invasion in osteosarcoma cell lines PMID: 21481226
a cytokine-triggered regulatory network for PCSK9 expression that is linked to JAKs and the ERK signaling pathway PMID: 21196532