Recombinant Human Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A) , partial

In Stock
Code CSB-MP871382HU1
Abbreviation Recombinant Human PPARGC1A protein, partial
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
Ligand effect modulator 6
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-300aa
Target Protein Sequence
MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDSFLGGLKWCSDQSEIISNQYNNEPSNIFEKIDEENEANLLAVLTETLDSLPVDEDGLPSFDALTDGDVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNECSGLSTQNHANHNHRIRTNPAIVKTENSWSNKAKSICQQQKPQRRPCSELLKYLTTNDDPPHTKPTENRNSSRDKCTSKKKSHTQSQSQHLQAKPTTLSLPLTPESPNDPKGSPFENKTIERTLSVELSGTAGLTPPTTP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
101.1 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-HSA-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcriptional coactivator for steroid receptors and nuclear receptors. Greatly increases the transcriptional activity of PPARG and thyroid hormone receptor on the uncoupling protein promoter. Can regulate key mitochondrial genes that contribute to the program of adaptive thermogenesis. Plays an essential role in metabolic reprogramming in response to dietary availability through coordination of the expression of a wide array of genes involved in glucose and fatty acid metabolism. Induces the expression of PERM1 in the skeletal muscle in an ESRRA-dependent manner. Also involved in the integration of the circadian rhythms and energy metabolism. Required for oscillatory expression of clock genes, such as ARNTL/BMAL1 and NR1D1, through the coactivation of RORA and RORC, and metabolic genes, such as PDK4 and PEPCK.
Gene References into Functions
  1. LL was significantly negatively correlated with PGC-1alpha, TNF-alpha, and IL-6 mRNA expressions. PGC-1alpha mRNA expression levels in paraspinal muscles may be affected by lumbar kyphosis. PMID: 30233161
  2. PGC1A can improve mitochondrial biogenesis and negatively regulate senescence, although this function of PGC1A in age-related macular degeneration needs further studies. Post-translational modifications of PGC1A by AMPK (AMP kinase) and SIRT1 (sirtuin 1) are crucial for its activation and important in age-related macular degeneration pathogenesis. PMID: 30087287
  3. study provides support for the involvement of both NFE2L2 and PPARGC1alpha in Parkinson's disease susceptibility and progression, marginally and through pathways involving maneb and paraquat exposure. PMID: 29630901
  4. Increased nuclear p53 phosphorylation and PGC-1alpha protein content immediately following SIE but not CE suggests these may represent important early molecular events in the exercise-induced response to exercise PMID: 28281651
  5. The transcriptional co-activator peroxisome proliferator-activated receptor gamma co-activator-1 alpha (PGC-1alpha) is proposed to coordinate skeletal muscle mitochondrial biogenesis through the integrated induction of nuclear- and mitochondrial-encoded gene transcription--{REVIEW} PMID: 29126696
  6. The changes of epigenetic modification of PGC-1alpha gene in pregnant women with gestational diabetes mellitus may be a mechanism of abnormal glucose metabolism in offspring. PMID: 29730292
  7. Our results showed that administration of Hcy reduced the SIRT1/AMPK/PGC-1alpha signaling in chondrocytes, leading to mitochondrial dysfunction as a result of increased oxidative stress and apoptosis PMID: 29413962
  8. Study in melanoma cell and in vivo melanoma models provides evidence for a direct role of BRD4 binding at super-enhancers that drive the expression of PGC-1alphaalpha and SOX10, a transcription factor involved in melanocyte development. PMID: 28991225
  9. the present study provided evidence that cisplatin stimulated the expression of PGC1A and the upregulation of mitochondrial biogenesis through PGC1A, promoting cell viability and inhibiting apoptosis in response to cisplatin treatment, thus triggering cisplatin resistance in ovarian cancer cells. PMID: 29749474
  10. At least in the subcutaneous fat of humans and mice, the levels of PGC-1a decrease during obesity, while its physical association with A20 increases. PMID: 29678181
  11. The non-responders for aerobic training are the carriers of PPARGC1A rs8192678 Ser/Ser. The best responders to aerobic training are PPARGC1A rs8192678 Gly/Gly carriers. PMID: 29762540
  12. Pathological cardiac hypertrophy, decrease of PGC-1alpha activity, and reactivation of the fetal genetic program in chronic heart failure are demonstrated. PMID: 29658071
  13. The findings suggest that activation of TGR5 promoted mitochondrial biogenesis in endothelial cells, which is mediated by the CREB/PGC-1a signaling pathway. PMID: 29709472
  14. that PGC-1alpha may be useful for predicting nodal metastasis, and may represent a biomarker for poor prognosis in colorectal cancer PMID: 29566941
  15. Koreans with the minor alleles of PGC-1alpha rs10517030, rs10517032 and rs10212638 are at greater risk of type 2 diabetes mellitus. PMID: 28488691
  16. It was found that down-regulated PGC-1alpha expression is independently associated with the development of CVD in HD patients. PMID: 28550474
  17. Results provide evidence that PGC-1A regulates FASN expression level in colorectal cancer cells. PMID: 29130104
  18. PPARGC1A expression is differentially regulated via canonical and alternative promoters in trained and untrained skeletal muscle. PMID: 29233908
  19. the results reveal that PGC-1alpha stimulates bioenergetic potential, which promotes breast cancer metastasis and facilitates adaptation to metabolic drugs. PMID: 28988825
  20. No associations were observed between SNPs in PPARGC1 and obesity. PMID: 28947843
  21. Results show that PGC1 function is modulated by ERRa which physically interacts with PGC1a, promoting the expression of genes involved in mitochondrial oxidative phosphorylation, but does not affect expression of the cellular antioxidant or invasive/metastatic programs. PMID: 28596418
  22. PGC-1alpha induction during differentiation is required for both mitochondrial biogenesis and commitment to the hepatocytic lineage, and TCF7L2 repression is sufficient to increase PGC-1alpha expression, mitochondrial biogenesis and OXPHOS activity. PMID: 28795454
  23. AMPK-PGC-1a control of mitochondrial reactive oxygen species regulates Warburg metabolism. PMID: 28978464
  24. Our results suggest that maternal inflammation programmed proneness to NF-kappaB over-activation which impaired PGC-1a-mediated anti-oxidant capacity resulting in the increased sensitivity of offspring to hypertensive damage. PMID: 27616627
  25. Postexercise cold water immersion of one limb also enhances PGC-1alpha expression. PMID: 28546467
  26. Multiple regression analysis showed that age, male gender, body max index, presence of obesity, type-2-diabetes mellitus, hypertension and coronary artery disease and left ventricular ejection fraction were associated with the expression levels of UCP1, PGC1alpha and PRDM16 mRNA PMID: 28824327
  27. This is the first study regarding the relationship of PPARGC1A and ADIPOQ polymorphisms, and the aggressiveness of prostate cancer in men with overweight or obesity. PMID: 28453464
  28. The effects of PGC-1 gene Gly482Ser polymorphisms on alterations in glucose and lipid metabolism induced by exercise training. PMID: 27699582
  29. acute upregulation of PGC-1alpha mRNA relates to the magnitude of subsequent training-induced increases in oxidative capacity, but not other molecular and morphological chronic skeletal muscle adaptations PMID: 28177701
  30. Data show a significant differential pattern of genetic association of peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (PGC-1alpha) among ethnic groups emphasizing the role of ethnicity towards disease susceptibility [Meta-analysis]. PMID: 29063962
  31. Findings suggest that despite their proposed involvement in the regulation of inflammatory processes in multiple sclerosis (MS), PPARalpha, PPARbeta/delta, and PGC-1alpha proteins are not potential biomarkers of neuroinflammation in MS, and indicate a preferential role of PPARgamma in the endogenous regulation of autoimmune response in the human central nervous system within its receptor family. PMID: 28483651
  32. this study shows that PPARGC1A rs3736265 G>A polymorphism is associated with decreased risk of type 2 diabetes mellitus and fasting plasma glucose PMID: 28418876
  33. Suggest that a pro-inflammatory diet may have a differential effect on colorectal cancer risk based on PPARGC1A genetic variation. PMID: 28051997
  34. that oxidatively-mediated reductions in parkin solubility and function in a mouse model of age-related sporadic PD coincides with increased PARIS levels and reduced PGC-1alpha signaling PMID: 27185595
  35. Study found that the metabolic master regulator PGC-1alpha is differentially affected by ALS-associated mutations in brain vs. peripheral tissues. Increased PGC-1alpha activity in peripheral tissue contributes to the metabolic phenotype, while in the CNS blunting of the PGC-1alpha response renders motoneurons vulnerable. PMID: 27818323
  36. A single nucleotide variant of the PPARGC1A gene (rs8192678) is associated with T2D susceptibility, relative risk of obesity and insulin resistance, and lower indices of beta cell function. This common polymorphism is within a highly conserved region of the bioactive protein and leads to a single amino acid substitution (glycine 482 to serine).[review] PMID: 29186342
  37. We aimed to explore the potential therapeutic effect of PGC-1alpha by generating a lentiviral vector to express human PGC-1alpha and target it by stereotaxic delivery to hippocampus and cortex of APP23 transgenic mice . Four months after hPGC-1alpha injection, mice showed improved spatial and recognition memory concomitant with a significant reduction in Abeta deposition, associated with a decrease in BACE1 expression PMID: 27791018
  38. In this review, we discuss the interplay between PGC-1 coactivators and cancer pathogenesis, including tumor initiation, metastatic spread, and response to treatment. Given their involvement in the functional biology of cancers, identification of regulatory targets that influence PGC-1 expression and activity may reveal novel strategies suitable for mono- or combinatorial cancer therapies. [Review] PMID: 28607951
  39. Physiologic plasma FFA elevation in NGT individuals has opposing effects on PGC-1alpha non-CpG residue methylation (CpT demethylation and increased DNMT-3B expression), which is correlated with changes in PGC-1alpha expression and skeletal muscle mitochondrial function PMID: 29261667
  40. IFNgamma induced PPAR gamma coactivator-1 alpha (PGC-1alpha) positively regulated RIG-I; with PRMT-1 and G9a affecting PGC-1alpha in a counter-regulatory manner. PMID: 26725954
  41. These results show the importance of the activation of the MC1R-PGC-1alpha pathway for mitochondrial biogenesis and function in melanoma development, as well as BRAF for the antioxidant response regulated by PGC-1alpha. PMID: 28452072
  42. Postexercise expression of PGC-1alpha gene via the alternative promoter was not affected. PMID: 28074493
  43. The present study investigated the neuroprotective effects and signal transduction mechanisms of the overexpression of PGC-1alpha on N-methyl-4-phenylpyridinium ion (MPP(+))-induced mitochondrial damage in SH-SY5Y cell. PMID: 26141122
  44. These data indicate that acute exercise in a hot environment blunts expression of mitochondrial biogenesis-related mRNA, due to decreased binding of CREB, MEF2, and FoxO1 to the PGC-1alpha promoter. PMID: 27445305
  45. skeletal muscle PGC-1alpha is required for fasting-induced upregulation of skeletal muscle SIRT3 and maintaining high fat oxidation in the fasted state, but is dispensable for preserving the capability to switch substrate during the transition from the fed to the fasted state and for fasting-induced PDH regulation in skeletal muscle. PMID: 28400503
  46. Conversely, nitric oxide (NO) triggered post translation modifications of PGC-1alpha and induced FAO, recovering the bioenergetics impairment of muscles but shunting the defective mitochondrial biogenesis. PMID: 27974213
  47. The results revealed that the distribution of genotypes and allele frequency of the PGC-1alpha Gly482Ser polymorphism in polycystic ovary syndrome patients was statistically significant from those of the control group respectively indicating that the presence of 'A' allele might confer risk to polycystic ovary syndrome. PMID: 29030253
  48. mitochondrial biogenesis using mdivi1 or by silencing PGC1alpha abrogates differentiation of Glioblastoma multiforme differentiation into astroglia; conversely, overexpression of PGC1alpha elicits differentiation. PMID: 28076790
  49. PGC-1alpha protein was higher after HIHVT than after SIT (p < 0.05). Moreover, the AMPKpTHR172/AMPK ratio increased at post after SIT (p < 0.05), whereas this effect was delayed after HIHVT as it increased after 3 h PMID: 28973039
  50. study demonstrated that PGC1alpha serves as a unique adaptor molecule for the recruitment of additional coactivator proteins, which can finely regulate HBV (Hepatitis B Virus) transcription PMID: 28768874

Show More

Hide All

Subcellular Location
[Isoform 1]: Nucleus. Nucleus, PML body.; [Isoform B4]: Nucleus.; [Isoform B4-8a]: Cytoplasm. Nucleus.; [Isoform B5]: Nucleus. Nucleus, PML body.; [Isoform 9]: Nucleus.
Tissue Specificity
Heart, skeletal muscle, liver and kidney. Expressed at lower levels in brain and pancreas and at very low levels in the intestine and white adipose tissue. In skeletal muscle, levels were lower in obese than in lean subjects and fasting induced a 2-fold i
Database Links

HGNC: 9237

OMIM: 604517

KEGG: hsa:10891

STRING: 9606.ENSP00000264867

UniGene: Hs.527078

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*