Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

NRG2

Uniprot No.

O14511

Research Area

Neuroscience

Alternative Names

Divergent of neuregulin 1; Divergent of neuregulin-1; Don 1; DON-1; Neural- and thymus-derived activator for ERBB kinases; Neuregulin 2; Neuregulin-2; NRG-2; Nrg2; NRG2_HUMAN; NTAK; Pro NRG2; Pro-NRG2

Species

Homo sapiens (Human)

Source

Yeast

Expression Region

112-405aa

Target Protein Sequence

CYSPSLKSVQDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKVKVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKAEELYQKR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

34.8kDa

Protein Length

Extracellular Domain

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Human NRG2 was expressed with the amino acid range of 112-405. The expected molecular weight for the NRG2 protein is calculated to be 34.8 kDa. This protein is generated in a yeast-based system. The NRG2 gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant NRG2 protein during the following stages.

The human pro-neuregulin-2 (NRG2) is a membrane-bound isoform of the NRG2 protein. pro-NRG2 is initially anchored to the cell membrane. Through proteolytic processing, it can be cleaved to release soluble fragments that act as ligands for ErbB receptor tyrosine kinases. Activation of ErbB receptors triggers intracellular signaling cascades that regulate cell growth, survival, and differentiation. NRG2 is expressed in various tissues, including the nervous system and the heart, suggesting its diverse functions in both neuronal and cardiac development. Research on pro-NRG2 spans neural and cardiovascular biology, exploring its contributions to cellular processes and its potential implications in diseases such as cancer and heart disorders.

Target Background

Function

Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor.

Gene References into Functions

reduced expression of NRG2 led to marginal increase in cell survival under arsenite-induced stress. PMID: 27345716
examination of the effect of isoforms on angiogenesis PMID: 14722120
Nrg-2-induced Acetylcholine Receptor transcription requires an N-box motif and is regulated by alternative splicing. PMID: 15961242
Linkage interval for GLC1M was refined to a smaller region. The NRG2 gene was excluded as the causative gene for juvenile-onset primary open angle glaucoma. PMID: 17563728
Gln43 of NRG2beta is both necessary and sufficient for NRG2 stimulation of ErbB4 coupling to IL3 independence. PMID: 17945187
NRG2 was positive in almost all breast cancers studied. High expression is related to the biological aggressiveness of breast cancer. PMID: 17962208

Hide All

Subcellular Location

[Pro-neuregulin-2, membrane-bound isoform]: Cell membrane; Single-pass type I membrane protein.; [Neuregulin-2]: Secreted.

Protein Families

Neuregulin family

Tissue Specificity

Restricted to the cerebellum in the adult.

Database Links

HGNC: 7998

OMIM: 603818

KEGG: hsa:9542

STRING: 9606.ENSP00000354910

UniGene: Hs.408515

Code	CSB-YP016078HU
Abbreviation	Recombinant Human NRG2 protein, partial
MSDS	MSDS Datasheet
Size	$250
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Pro-neuregulin-2, membrane-bound isoform (NRG2), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage