Recombinant Human Programmed cell death 1 ligand 1(CD274),partial

Code CSB-MP878942HU1
Product Type Recombinant Protein
Size US$1109
Uniprot No. Q9NZQ7
Abbreviation CD274
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
Research Area Cancer
Source Mammalian cell
Gene Names CD274
Protein Names Recommended name: Programmed cell death 1 ligand 1 Short name= PD-L1 Short name= PDCD1 ligand 1 Short name= Programmed death ligand 1Alternative name(s): B7 homolog 1 Short name= B7-H1 CD_antigen= CD274
Expression Region 19-238aa
Tag Info C-terminal FC-tagged
Mol. Weight 52.7 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the costimulatory signal, essential for T-cell proliferation and production of IL10 and IFNG, in an IL2-dependent and a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation and cytokine production.
Subcellular Location Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Endomembrane system, Single-pass type I membrane protein
Protein Families Immunoglobulin superfamily, BTN/MOG family
Tissue Specificity Highly expressed in the heart, skeletal muscle, placenta and lung. Weakly expressed in the thymus, spleen, kidney and liver. Expressed on activated T- and B-cells, dendritic cells, keratinocytes and monocytes.
Database Links

HGNC: 17635

OMIM: 605402

KEGG: hsa:29126

STRING: 9606.ENSP00000370989

UniGene: Hs.521989

Related Products

CD274 Antibodies

CD274 Antibodies for Homo sapiens (Human)

CD274 Antibodies for Human

CD274 Proteins

CD274 Proteins for Homo sapiens (Human)

CD274 ELISA Kit

CD274 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.