Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized PD-L1 at 2 μg/ml can bind Anti- PD-L1 mouse monoclonal antibody(CSB-MA878942A1m,antigen from E.coli), the EC50 of human PD-L1 protein is 1.252-1.653 ng/mL.
Alternative Names
B7 H; B7 H1; B7 homolog 1; B7-H1; B7H; B7H1; CD 274; CD274; CD274 antigen; CD274 molecule; MGC142294; MGC142296; OTTHUMP00000021029 ; PD L1; PD-L1; PD1L1_HUMAN; PDCD1 ligand 1; PDCD1L1; PDCD1LG1; PDL 1; PDL1; Programmed cell death 1 ligand 1; Programmed death ligand 1; RGD1566211
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
19-238aa
Target Protein Sequence
FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
Tag Info
C-terminal hFc-tagged
Form
Liquid or Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3
working days after receiving your orders. Delivery time may differ from different purchasing way or
location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with
normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance
and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The Human Programmed cell death 1 ligand 1 (CD274) is a protein that participates in the adaptative immune response and the cell surface receptor pathway. This protein is the ligand for the inhibitory receptor PDCD1/PD-1 that regulates the activity of T-cells and limits their response. This recombinant protein is prepared by the expression of the 19-238aa region of the human CD274 in mammalian cells.It was fused on the C-terminus with a TEV linker and an immunoglobulin Fc domain tag for purification and immobilization purposes. The expressed protein has a molecular weight of 52.7 kDa. This product has a purity higher than 95%, as measured by SDS-PAGE. Its EC50 for the binding with human PD-L1 protein determined by a functional ELISA is 1.252-1.653 ng/mL. The final product has low levels of endotoxin as determined by LAL method. This recombinant protein could be used in cancer research as its increased expression in tumors promotes immune evasion and tumor cell growth by suppressing T-cell activity.Therefore, it becomes a target for the anti-PD-L1 pathway immunomodulation cancer therapy.