Recombinant Human Ras-related protein R-Ras2(RRAS2)

Code CSB-EP020514HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P62070
Relevance It is a plasma membrane-associated GTP-binding protein with GTPase activity. Might transduce growth inhibitory signals across the cell membrane, exerting its effect through an effector shared with the Ras proteins but in an antagonistic fashion.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Ras-like protein TC21Teratocarcinoma oncogene
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF
Research Area Signal Transduction
Source E.coli
Gene Names RRAS2
Protein Names Recommended name: Ras-related protein R-Ras2Alternative name(s): Ras-like protein TC21 Teratocarcinoma oncogene
Expression Region 50.1kDa
Tag Info N-terminal GST-tagged
Mol. Weight 50.1kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function It is a plasma membrane-associated GTP-binding protein with GTPase activity. Might transduce growth inhibitory signals across the cell membrane, exerting its effect through an effector shared with the Ras proteins but in an antagonistic fashion.
Involvement in disease Ovarian cancer (OC)
Subcellular Location Cell membrane, Lipid-anchor, Cytoplasmic side
Protein Families Small GTPase superfamily, Ras family
Tissue Specificity Ubiquitously present in all tissues examined, with the highest levels in heart, placenta, and skeletal muscle. Moderate levels in lung and liver; low levels in brain, kidney, and pancreas.
Database Links

HGNC: 17271

OMIM: 167000

KEGG: hsa:22800

STRING: 9606.ENSP00000256196

UniGene: Hs.502004

Pathway cAMP signaling pathway
MAPK signaling pathway
Regulation of actin cytoskeleton
Autophagy
Cellular senescence
Ras signaling pathway
Apelin signaling pathway
Phospholipase D signaling pathway

Related Products

RRAS2 Antibodies

RRAS2 Antibodies for Homo sapiens (Human)

RRAS2 Antibodies for Human

RRAS2 Proteins

RRAS2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.