Recombinant Human Retinoschisin(RS1)

Code CSB-EP020534HUe0
Product Type Recombinant Protein
Size US$1726
Uniprot No. O15537
Relevance May be active in cell adhesion processes during retinal development.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias X-linked juvenile retinoschisis protein
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence STEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCA
Research Area Cell Adhesion
Source E.coli
Gene Names RS1
Expression Region 24-224aa
Tag Info N-terminal GST-tagged
Mol. Weight 50.0kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Binds negatively charged membrane lipids, such as phosphatidylserine and phosphoinositides (By similarity). May play a role in cell-cell adhesion processes in the retina, via homomeric interaction between octamers present on the surface of two neighboring cells
Involvement in disease Retinoschisis juvenile X-linked 1 (XLRS1)
Subcellular Location Secreted, Cell membrane, Peripheral membrane protein, Extracellular side
Tissue Specificity Restricted to the retina (at protein level) (PubMed:10915776). Detected in the inner segment of the photoreceptors, the inner nuclear layer, the inner plexiform layer and the ganglion cell layer (at protein level). At the macula, expressed in both the out
Database Links

HGNC: 10457

OMIM: 300839

KEGG: hsa:6247

STRING: 9606.ENSP00000369320

UniGene: Hs.715725

Related Products

RS1 Antibodies

RS1 Antibodies for Homo sapiens (Human)

RS1 Proteins

RS1 Proteins for Homo sapiens (Human)

RS1 ELISA Kit

RS1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.