Product Details

Purity

≥ 95% as determined by SDS-PAGE.
≥ 95% as determined by SEC-HPLC.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

①Measured by its binding ability in a functional ELISA.Immobilized Human SLAMF7 at 2 μg/mL can bind anti-SLAMF7 recombinant antibody(CSB-RA021369MA1HU).The EC50 is 8.949-10.33 ng/mL.
②SLAMF7 Recombinant Monoclonal Antibody(CSB-RA021369MA1HU) captured on Protein A Chip can bind Human SLAMF7 with an affinity constant of 0.18 nM as detected by MetaSPR Assay (WeSPRTM 200).

Target Names

SLAMF7

Uniprot No.

Q9NQ25

Alternative Names

SLAM family member 7; CD2 subset 1; CD2-like receptor-activating cytotoxic cells; CRACC; Membrane protein FOAP-12; Novel Ly9; Protein 19A; CD antigen CD319

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

23-226aa

Target Protein Sequence

SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM

Mol. Weight

23.8 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

SLAMF7 (CD319) is a self-ligand receptor expressed on natural killer cells, activated T cells, and multiple myeloma cells, making it a validated target for cancer immunotherapy and a key marker in hematologic malignancies. This mammalian-expressed extracellular domain (aa 23–226) exhibits a binding affinity of 0.18 nM to an anti-SLAMF7 monoclonal antibody as measured by surface plasmon resonance, demonstrating the conformational integrity required for therapeutic antibody epitope mapping, competitive inhibition screening, and receptor-ligand interaction studies. The protein supports use in functional ELISA with an EC50 of 8.9–10.3 ng/mL when immobilized at 2 μg/mL, providing quantitative benchmarks for blocking antibody validation and small-molecule inhibitor screening in oncology drug discovery. Endotoxin levels below 1.0 EU/μg and purity exceeding 95% meet the quality thresholds commonly required for SPR affinity characterization and biolayer interferometry assays in immune checkpoint research.

Target Background

Function

Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Isoform 1 mediates NK cell activation through a SH2D1A-independent extracellular signal-regulated ERK-mediated pathway. Positively regulates NK cell functions by a mechanism dependent on phosphorylated SH2D1B. Downstream signaling implicates PLCG1, PLCG2 and PI3K. In addition to heterotypic NK cells-target cells interactions also homotypic interactions between NK cells may contribute to activation. However, in the absence of SH2D1B, inhibits NK cell function. Acts also inhibitory in T-cells. May play a role in lymphocyte adhesion. In LPS-activated monocytes negatively regulates production of proinflammatory cytokines.; Isoform 3 does not mediate any NK cell activation.

Gene References into Functions

Memory CD8+ T cells from SLE patients displayed decreased amounts of SLAMF7, a surface receptor that characterizes effector CD8+ T cells. Ligation of SLAMF7 increased CD8+ T cell degranulation capacity and the percentage of IFNgamma-producing cells in response to antigen challenge in SLE patients and healthy controls. SLAMF7 engagement promoted cytotoxic lysis of target cells in response to stimulation with viral antig... PMID: 28076903
phagocytosis of haematopoietic tumour cells during SIRPalpha-CD47 blockade was strictly dependent on SLAM family receptors in vitro and in vivo; in both mouse and human cells, this function required a single SLAM family member, SLAMF7 (also known as CRACC, CS1, CD319), expressed on macrophages and tumour cell targets PMID: 28424516
Cohort statistics revealed a significant increase of circulating sSLAMF7 in multiple myeloma patients versus normal controls PMID: 27116021
Blimp-1 regulates the transcription of CS1 gene in NK and B cell lines from multiple myeloma and diffuse large B cell lymphoma patients. PMID: 26310579
SLAMF7-triggered inhibition is mediated by a mechanism involving Src kinases, CD45, and SHIP-1 that is defective in MM cells PMID: 25312647
Our data highlight the therapeutic potential of targeting CD319 in rheumatoid arthritis PMID: 24299175
SLAMF7 plays an inhibitory role in human monocytes to control proinflammatory immune responses. PMID: 23695528
These results suggest a role for CD319 and CD229 in the systemic lupus erythematosus disease process. PMID: 23956418
These data suggest an involvement of CRACC-mediated NK cell activation in periodontal tissue destruction and point to a plausible distinction in the pathobiology of aggressive and chronic periodontitis. PMID: 23250953
CS1-L and CS1-S may differentially regulate human NK cell functions PMID: 15368295
CS1 may play a role in the regulation of B lymphocyte proliferation during immune responses PMID: 17878365
CS1 was expressed at adhesion-promoting uropod membranes of polarized Multiple Myeloma cells, andis required for MM cell adhesion to bone marrow stromal cells PMID: 17906076
HuLuc63 eliminates myeloma cells, at least in part, via NK-mediated ADCC and shows the therapeutic potential of targeting CS1 with HuLuc63 for the treatment of multiple myeloma. PMID: 18451245

Hide All

Subcellular Location

Membrane; Single-pass type I membrane protein.

Tissue Specificity

Expressed in spleen, lymph node, peripheral blood leukocytes, bone marrow, small intestine, stomach, appendix, lung and trachea. Expression was detected in NK cells, activated B-cells, NK-cell line but not in promyelocytic, B-, or T-cell lines. Expressed

Database Links

HGNC: 21394

OMIM: 606625

KEGG: hsa:57823

STRING: 9606.ENSP00000357022

UniGene: Hs.517265

Code	CSB-MP021369HU
Abbreviation	Recombinant Human SLAMF7 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$98
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA.Immobilized Human SLAMF7 at 2 μg/ml can bind anti-SLAMF7 recombinant antibody(CSB-RA021369MA1HU).The EC₅₀ is 8.949-10.33 ng/mL. Biological Activity Assay Activity SLAMF7 Recombinant Monoclonal Antibody(CSB-RA021369MA1HU) captured on Protein A Chip can bind Human SLAMF7 with an affinity constant of 0.18 nM as detected by MetaSPR Assay (WeSPRTM 200). Biological Activity Assay The purity of SLAMF7 was greater than 95% as determined by SEC-HPLC
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human SLAM family member 7 (SLAMF7), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage