Recombinant Human TGF-beta receptor type-2 (TGFBR2), partial (Active)

In Stock
Code CSB-MP023452HU2
Abbreviation Recombinant Human TGFBR2 protein, partial (Active)
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human TGFB3 (CSB-MP023449HU2) at 2 μg/ml can bind Human TGFBR2. The EC50 is 6.173-7.152 ng/mL. Biological Activity Assay
  • Activity
    Human TGFBR2 captured on Protein A Chip can bind Recombinant Human TGFB3 (CSB-MP023449HU2) with an affinity constant of 1.92 nM as detected by MetaSPR Assay (WeSPRTM 200). Biological Activity Assay
  • The purity of TGFBR2 was greater than 90% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
≥ 90% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human TGFB3 (CSB-MP023449HU2) at 2 μg/mL can bind Human TGFBR2. The EC50 is 6.173-7.152 ng/mL.
②Human TGFBR2 captured on Protein A Chip can bind Recombinant Human TGFB3 (CSB-MP023449HU2) with an affinity constant of 1.92 nM as detected by MetaSPR Assay (WeSPRTM 200).
Target Names
Uniprot No.
Alternative Names
TGF-beta receptor type-2; TGFR-2; EC 2.7.11.30; TGF-beta type II receptor; Transforming growth factor-beta receptor type II; TGF-beta receptor type II; TbetaR-II
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
23-159aa
Target Protein Sequence
TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPD
Mol. Weight
41.6 kDa
Protein Length
Partial
Tag Info
N-terminal hFc1-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transmembrane serine/threonine kinase forming with the TGF-beta type I serine/threonine kinase receptor, TGFBR1, the non-promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and is thus regulating a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and the activation of TGFRB1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways.
Gene References into Functions
  1. Data show that activated proto-oncogene protein Akt (AKT) directly phosphorylates Fas associated factor 1 (FAF1) reduces FAF1 at the plasma membrane and results in an increase in TGF-beta type II receptor (TbetaRII) at the cell surface. PMID: 28443643
  2. TGFBR2 Polymorphisms Are Associated with Colorectal Cancer in Patients with Lynch Syndrome. PMID: 30275229
  3. This study has confirmed or corrected the clinical diagnosis, and enlarged the mutation spectrum of FBN1 and TGFBR2 and confirmed that parental mosaicism may be the cause of the varied phenotypic expression of these connective tissue disorders.The results should be helpful for prenatal diagnosis and genetic counseling. PMID: 30101859
  4. the restoration of TGFBR2 in miR-204 overexpression Gastric cancer (GC) cells, which recovered resistance to 5-FU treatments compared with miR-204 overexpression GC cells. PMID: 29940566
  5. MiR-9-5p promotes the proliferation, metastasis and invasion of non-small cell lung cancer cells by down-regulating TGFBR2 expression. PMID: 29239816
  6. Microarray-based analyses revealed that the expression of miR-20b was significantly increased, whereas TGFBR2 and MYC were significantly downregulated and upregulated, respectively, in all ES cells compared to their expression in human mesenchymal stem cells (hMSCs). PMID: 29039480
  7. this study provides evidence that TGFBR2 rs6785358 polymorphism might be associated with the risk of hypospadias. PMID: 28894026
  8. Down-regulation of TGF-beta RII was found in the invasive non-functioning pituitary adenomas compared to noninvasive ones. PMID: 29031543
  9. findings reveal a novel role for miR-204/ANGPT1/TGFbetaR2 axis in tumor angiogenesis. We propose that therapeutic manipulation of miR-204 levels may represent a promising approach in breast cancer. PMID: 27703260
  10. High TGFBR2 expression is associated with small cell lung cancer. PMID: 28055980
  11. expression induced by IL-6 in keratinocytes PMID: 27892604
  12. hsa-miR-1193 may be involved in sporadic colorectal cancer tumourigenesis at least in part by suppression of TGFBR2, and the A allele of rs11466537 disturbed the regulation of hsa-miR-1193 on TGFBR2. PMID: 28494187
  13. Results show that TGFbR2 expression decreases in human gastric cancer (GC) tissue specimens and indicate that the expression of TGFbR2 is mainly dependent on post-transcriptional regulators in GC through miR-155 binding to the 3'-UTR of its mRNA. PMID: 29247570
  14. This study demonstrated that Increased Transforming Growth Factor beta2 in the Neocortex of Alzheimer's Disease and Dementia with Lewy Bodies is Correlated with Disease Severity and Soluble Abeta42 Load. PMID: 27911312
  15. Data indicate the most significant gene level association seen with transforming growth factor beta receptor 2 (TGFBR2) and clear cell epithelial ovarian cancer (EOC). PMID: 27533245
  16. Abnormal expression of TGF-beta type II receptor isoforms contributes to prognosis in acute myeloid leukemia. PMID: 28052022
  17. altered Tgfbeta signaling in cultured mouse and human enteroids supports further the in vivo data and reveals a critical role for Tgfbeta signaling in generating precursor secretory cells. Overall, our data reveal a key role for Tgfbeta signaling in regulating ISCs clonal dynamics and differentiation, with implications for cancer, tissue regeneration, and inflammation. PMID: 27791005
  18. MiR-130 is up-regulated in gastric cancer (GC) tissues and directly targets TGF-beta type II receptor (TGFbetaR2). PMID: 27304191
  19. miR-17-5p negatively regulated TGFBR2 expression by directly binding to the 3'UTR of TGFBR2 mRNA, thereby promoting gastric cancer cell growth and migration. PMID: 27120811
  20. High TGFBR2 expression is associated with mesenchymal to epithelial transition of breast cancer. PMID: 28987542
  21. Inhibition of TGFBR2 had the similar effect as miR-9 overexpression. PMID: 27756824
  22. we describe and characterize the functional impact of a novel VUS in the TGFBR2 kinase domain (c.1255G>T; p.Val419Leu), in a patient with the clinical diagnosis of Marfan syndrome spectrum. Our results establish that the V419L variant leads to aberrant TGF-beta signaling and confirm the diagnosis of Loeys-Dietz syndrome in this patient. PMID: 28679693
  23. Apo and inhibitor-bound TGFBR2 kinase structures are presented at high resolution (<2 A). PMID: 27139629
  24. TGF-beta type I, II, and III receptors were all identified in pregnant serum; all were substantially elevated in early-onset but not late-onset PE. Endoglin was increased in both subtypes. PMID: 28633389
  25. this is the first clinical report to demonstrate a potential causal association between TGFB2 gene mutations and aortic root dilatation in combination with the myxomatous degeneration of both atrioventricular valves. PMID: 28633253
  26. Molecular modeling and molecular dynamic simulation of the effects of variants in the TGFBR2 kinase domain as a paradigm for interpretation of variants obtained by next generation sequencing. PMID: 28182693
  27. A novel mutation in the TGFBR2 gene was identified in a patient with Loeys-Dietz syndrome. PMID: 28344185
  28. ZNF32 was found to directly bind to the TGF-betaR2 (transforming growth factor-beta receptor 2) promoter to promote its expression. PMID: 27763636
  29. High TGFBR2 expression is associated with glioma. PMID: 28184932
  30. these findings delineate the important function of the TGFbeta signaling pathway in the early development of kidney and TbetaRII was shown to be able to promote the expression of Six2 through Smad3 mediating transcriptional regulation and in turn activate the proliferation of MM cells. PMID: 28420207
  31. YAP-1 promotes Tregs differentiation in hepatocellular carcinoma by enhancing TGFBR2 transcription. PMID: 28472799
  32. Gasdermin C is upregulated by inactivation of Tgfbr2 in the presence of mutated Apc, promoting colorectal cancer cell proliferation. PMID: 27835699
  33. Depending on the TGFBR2 expression status of their donor cells, shed exosomes show distinct proteomic signatures and promote altered cytokine secretion profiles in recipient cells. PMID: 28376875
  34. miR-520f inhibited tumor cell invasion by directly targeting ADAM9 and the TGFbeta receptor TGFBR2. PMID: 28209612
  35. Study demonstrated that the TGFBR2 mutation was not present in the sample of cervico-cerebral artery dissection patients (CCAD); however, a positive association was identified between the MTHFR-C677T polymorphism and genetically confirmed Mexican mestizo spontaneous CCAD patients PMID: 27017342
  36. A genetic investigation found a TGFbetaR2 gene mutation, leading to the diagnosis of Loeys-Dietz syndrome type2. PMID: 27017362
  37. The results showed that transfection of CD34(+) cells with SiRNA targeting TGF-bRII and their co-culture with human bone marrow mesenchymal stromal cells (MSCs) could considerably increase the number of progenitors PMID: 27344285
  38. Cell invasion (matrigel) was reduced only in the Hs578T cells (p < 0.01). Silencing decreased the expression of the prometastatic molecules S100A4 and TGFbetaR2 in both cell lines and CD44 in Hs578T cells. We conclude that ECM1 is a key player in the metastatic process and regulates the actin cytoskeletal architecture of aggressive breast cancer cells at least in part via alterations in S100A4 and Rho A. PMID: 27770373
  39. Our study uncovers a novel mechanism that miR-19a-3p/19b-3p inhibits autophagy-mediated fibrogenesis by targeting TGF-beta R II. PMID: 27098600
  40. TGFBR2 signaling can affect Notch1 glycosylation via regulation of glycosyltransferase LFNG expression and provide a first mechanistic example for altered glycosylation in microsatellite instability colorectal tumor cells. PMID: 27156840
  41. CD44 and TGFBR2 are the functional targets of miR-373, which are responsible for the tumor suppressive functions of miR-373 PMID: 26858153
  42. Polymorphism of TGFBR2 is associated with coronary artery disease. PMID: 27234600
  43. Results found TGFBR2 to be significantly related to the regulated phosphoproteome in glioblastoma as a result of integrative upstream kinase/ regulator analyses and experimentally validated as a novel regulator of glioblastoma stem cells. PMID: 26670566
  44. Reduced expression of TGF-beta type II receptor and extracellular matrix components in response to reduced fibroblast size/mechanical force was fully reversed by restoring size/mechanical force PMID: 26780887
  45. results suggested that high CDKN1A/p21 and low TGFBR2 expression was closely correlated with adverse pathological parameters and poor prognosis in breast cancer. PMID: 26823785
  46. Findings suggest that the upregulation of miR-590-5p promotes cellular malignant behavior via the target gene TGFbetaRII in vulvar squamous cell carcinoma. PMID: 26498065
  47. TGFBR2 is regulated by an epigenetic auto-feedback regulation in non-small cell lung cancer. PMID: 26356817
  48. we reported a sporadic Japanese case of LDS with a novel TGFBR2 p.Y424H mutation, which appeared to cause pregnancy-related fatal aortic/arterial dissections. PMID: 26301661
  49. AT2R downregulates the expression of TGF-betaRII in human proximal tubule cells PMID: 26867007
  50. High levels of TbetaRII expression were associated with lymph node metastasis, increasing tumor clinical stage, and poorer 5-year disease-free survival in patients with breast cancer. TbetaRII may be a potential prognostic marker for breast cancer. PMID: 26551005

Show More

Hide All

Involvement in disease
Hereditary non-polyposis colorectal cancer 6 (HNPCC6); Esophageal cancer (ESCR); Loeys-Dietz syndrome 2 (LDS2)
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Membrane raft.
Protein Families
Protein kinase superfamily, TKL Ser/Thr protein kinase family, TGFB receptor subfamily
Database Links

HGNC: 11773

OMIM: 133239

KEGG: hsa:7048

STRING: 9606.ENSP00000351905

UniGene: Hs.604277

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*