Recombinant Human papillomavirus type 16 Protein E7(E7)

In Stock
Code CSB-EP365855HML
Product Type Recombinant Protein
Size US$1726Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P03129
Relevance E7 protein has both transforming and trans-activating activities. Disrupts the function of host retinoblastoma protein RB1/pRb, which is a key regulator of the cell cycle. Induces the disassbly of the E2F1 transcription factors from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Inactivation of the ability of RB1 to arrest the cell cycle is critical for cellular transformation, uncontrolled cellular growth and proliferation induced by viral infection. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. Interferes with histone deacetylation mediated by HDAC1 and HDAC2, leading to activation of transcription .
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP365855HML could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) E7.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP365855HML could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) E7.
Storage Buffer Tris-based buffer,50% glycerol
Species Human papillomavirus type 16
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
Research Area Epigenetics and Nuclear Signaling
Source E.coli
Gene Names E7
Expression Region 1-98aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 15.0 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Plays also a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta).
Subcellular Location Host cytoplasm, Host nucleus
Protein Families Papillomaviridae E7 protein family
Database Links

KEGG: vg:1489079

Q&A and Customer Reviews

Q&A
Q:

Would you have the recipe for the Tris buffer that you could share? If not, the recipe can you share the molarity and the pH of the Tris buffer?

A:
Thanks for your inquiry. The buffer composition is as follows: 20mM Tris-HCl, 0.5M NaCl, pH 8.0, 50% glycerol.
Customer Reviews

Related Products

E7 Antibodies

E7 Antibodies for Human papillomavirus type 16

E7 Proteins

E7 Proteins for Human papillomavirus type 16

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.