Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-YP365855HML |
| Product Type | Recombinant Protein |
| Size | US$2010 |
| Uniprot No. | P03129 |
| Storage Buffer | Tris-based buffer，50% glycerol |
| Species | Human papillomavirus type 16 |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Sequence | MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP |
| Research Area | Epigenetics and Nuclear Signaling |
| Source | Yeast |
| Gene Names | E7 |
| Protein Names | Recommended name: Protein E7 |
| Expression Region | 1-98aa |
| Tag Info | N-terminal 6xHis-tagged |
| Mol. Weight | 13.0 kDa |
| Protein Description | Full Length |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Plays also a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta). |
| Subcellular Location | Host cytoplasm, Host nucleus |
| Protein Families | Papillomaviridae E7 protein family |
| Database Links |
KEGG: vg:1489079 |
We are interested in your protein CSB-YP365855HML, however we would like to know if the lab has been able to express this protein in yeast expression system. We want to know how successful the expression will be for this protein.
We have a question regarding Recombinant Human papillomavirus type 16 Protein E7 (E7) (CSB-YP365855HML)
We would like to know which type of yeast the lab is using for the expression: is it S. cervisae or Pichia pastoris?
MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
E7 Antibodies for Human papillomavirus type 16
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA365855ZA01HML | E7 Antibody | Human papillomavirus type 16 | ELISA, WB (ensure identification of antigen) |
| CSB-PA365855ZA01HML | E7 Antibody | Human papillomavirus type 16 | ELISA, WB (ensure identification of antigen) |
E7 Proteins for Human papillomavirus type 16
| Code | Product Name | Source |
|---|---|---|
| CSB-EP365855HMLe0 | Recombinant Human papillomavirus type 16 Protein E7(E7) | E.coli |
| CSB-BP365855HML CSB-MP365855HML |
Recombinant Human papillomavirus type 16 Protein E7(E7) | Baculovirus Mammalian cell |
| CSB-EP365855HML | Recombinant Human papillomavirus type 16 Protein E7(E7) | E.coli |
Recombinant Rat Vascular endothelial growth factor A(Vegfa)
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Rabbit E-selectin (SELE),partial
Express system: Yeast
Species: Oryctolagus cuniculus (Rabbit)
Recombinant Human Mannan-binding lectin serine protease 1(MASP1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Casein kinase I isoform epsilon(CSNK1E)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rat Myosin-binding protein C, cardiac-type(Mybpc3),partial
Express system: Yeast
Species: Rattus norvegicus (Rat)
Recombinant Mouse Lysyl oxidase homolog 2(Loxl2)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Mouse Superoxide dismutase [Cu-Zn](Sod1)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Glycogen phosphorylase, liver form(PYGL),partial
Express system: E.coli
Species: Homo sapiens (Human)
