Code | CSB-YP365855HML |
Size | US$2010 |
Purity | Greater than 85% as determined by SDS-PAGE. |
Target Names | E7 |
Uniprot No. | P03129 |
Research Area | Epigenetics and Nuclear Signaling |
Species | Human papillomavirus type 16 |
Source | Yeast |
Expression Region | 1-98aa |
Target Protein Sequence | MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 13.0 kDa |
Protein Length | Full Length |
Tag Info | N-terminal 6xHis-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
Datasheet & COA | Please contact us to get it. |
Still Have Questions? | Leave a Message or Start an on-line Chat |
We are interested in your protein CSB-YP365855HML, however we would like to know if the lab has been able to express this protein in yeast expression system. We want to know how successful the expression will be for this protein.
We have a question regarding Recombinant Human papillomavirus type 16 Protein E7 (E7) (CSB-YP365855HML)
We would like to know which type of yeast the lab is using for the expression: is it S. cervisae or Pichia pastoris?
MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
Function | Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Plays also a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta). |
Subcellular Location | Host cytoplasm, Host nucleus |
Protein Families | Papillomaviridae E7 protein family |
Database Links |
KEGG: vg:1489079 |
Recombinant Mouse CCN family member 2(Ccn2),partial
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Ecto-NOX disulfide-thiol exchanger 2(ENOX2)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Low-density lipoprotein receptor-related protein 2(LRP2),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Protein disulfide-isomerase A3(PDIA3)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human F-box/LRR-repeat protein 2(FBXL2)
Express system: E.coli
Species: Homo sapiens (Human)
Tel: 301-363-4651
Email: support@cusabio.com
Distributors Worldwide