Code | CSB-YP365855HML |
MSDS | |
Size | $250 |
Order now | |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
We are interested in your protein CSB-YP365855HML, however we would like to know if the lab has been able to express this protein in yeast expression system. We want to know how successful the expression will be for this protein.
We have a question regarding Recombinant Human papillomavirus type 16 Protein E7 (E7) (CSB-YP365855HML)
We would like to know which type of yeast the lab is using for the expression: is it S. cervisae or Pichia pastoris?
MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
KEGG: vg:1489079