Recombinant Human papillomavirus type 16 Protein E7(E7)

Code CSB-YP365855HML
Product Type Recombinant Protein
Size US$2010
Uniprot No. P03129
Storage Buffer Tris-based buffer,50% glycerol
Species Human papillomavirus type 16
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
Research Area Epigenetics and Nuclear Signaling
Source Yeast
Gene Names E7
Protein Names Recommended name: Protein E7
Expression Region 1-98aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 13.0 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Plays also a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta).
Subcellular Location Host cytoplasm, Host nucleus
Protein Families Papillomaviridae E7 protein family
Database Links

KEGG: vg:1489079

Q&A and Customer Reviews

Q&A
Q:

We are interested in your protein CSB-YP365855HML, however we would like to know if the lab has been able to express this protein in yeast expression system. We want to know how successful the expression will be for this protein.

A:
Regarding the CSB-YP365855HML, we expressed it long time ago, probably the strains are somewhat degraded, so we will further optimize it, in theory the success rate is relatively higher.
Q:

We have a question regarding Recombinant Human papillomavirus type 16 Protein E7 (E7) (CSB-YP365855HML)
We would like to know which type of yeast the lab is using for the expression: is it S. cervisae or Pichia pastoris?

A:
Thanks for your inquiry.
Recombinant Human papillomavirus type 16 Protein E7(E7)
CSB-YP365855HML >> Yeast
Tag information:Tag type will be determined during the manufacturing process.
The expected tag is N-terminal 6xHis-tagged
Target Protein Sequence:

MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP


We use Pichia pastoris for the Yeast expression system.
Customer Reviews

Related Products

E7 Antibodies

E7 Antibodies for Human papillomavirus type 16

E7 Proteins

E7 Proteins for Human papillomavirus type 16

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.