Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Measured by its binding ability in a functional ELISA. Immobilized HPV16 E7 at 10 μg/mL can bind Biotinylated MYC(CSB-EP015270HU-B), the EC50 is 268.1-354.3 ng/mL.
Research Area
Microbiology
Molecular Characterization
Species
Human papillomavirus type 16
Target Protein Sequence
MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged and C-terminal 6xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Recombinant human papillomavirus 16 E7 protein is an Escherichia coli full-length protein tagged with 6xHis at both the N-terminus and C-terminus. Its encoding region corresponds to 1 to 98 AA of the human papillomavirus type 16 E7 protein. It is characterized by high purity (> 90%, SDS-PAGE) and biological activity. Under the reducing conditions, this E7 protein has an apparent molecular mass of approximately 20 kDa. The activity of this E7 protein was assessed by binding it to the biotinylated MYV in a functional ELISA, and the EC50 is 268.1-354.3 ng/mL. This E7 protein may be used in the studies of human papillomavirus type 16-associated infection. It is in stock now.
E7, one of the major HPV oncoproteins, activates the cell cycle progression by promoting the degradation of the inactivation of retinoblastoma protein (pRb). Kathryn H. Richards et al. demonstrated that E7 is the major inhibitor of imiquimod-induced inflammatory responses in primary keratinocytes.