Recombinant Human papillomavirus type 16 Protein E7(E7)

Code CSB-EP365855HMLe0
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP365855HMLe0 could indicate that this peptide derived from E.coli-expressed Human papillomavirus type 16 E7.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP365855HMLe0 could indicate that this peptide derived from E.coli-expressed Human papillomavirus type 16 E7.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names E7
Uniprot No. P03129
Research Area Epigenetics and Nuclear Signaling
Alternative Names E7; Protein E7
Species Human papillomavirus type 16
Source E.coli
Expression Region 1-98aa
Target Protein Sequence MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 38.0 kDa
Protein Length Full Length
Tag Info N-terminal GST-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Plays also a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta).
Gene References into Functions
  1. A role for E7 protein in regulation of Langerhans cells homeostasis in the skin and in suppression of antigen specific CD8 T cell expansion. PMID: 27708419
  2. E7 oncogene alters host gene expression in the cervical stroma. PMID: 29073104
  3. direct evidence that both A3A and HPV16 E7 interact with CUL2, suggesting that the E7-CUL2 complex formed during HPV infection may regulate A3A protein levels in the cell. PMID: 29367246
  4. Results suggest that E7 recruited CUL2, driven by CUL2/E2F1/miR-424 regulatory loop, is overexpressed and accelerates HPV16-induced cervical carcinogenesis. PMID: 27153550
  5. The human papillomavirus E7 oncoprotein is a regulator of host transcription. (Review) PMID: 27818212
  6. Findings indicate the interaction network of viral oncogene HPV16 E7, miR-27b and PLK2, and support the potential strategies using antisense nucleic acid of miR-27b for therapy of cervical cancer. PMID: 26910911
  7. Based on experimental data obtained from E7 proteins from the prototypical viral types 16, 18 and 11, we identified a couple of low pKa nucleophilic cysteines that can form a disulfide bridge upon the exposure to ROS and regulate the cytoplasm to nucleus transport PMID: 27863297
  8. E7 is major transforming oncoprotein of human papillomavirus 16 and serves as paradigmatic example of intrinsically disordered proteins due to its N-terminal disordered domain. Data suggest mutation of leucines in N-terminal intrinsically disordered domain of E7 leads to pronounced increase in both alpha-helix and beta-sheet structures; thus, E7 appears to exhibit local structural elements that oppose canonical folding. PMID: 28952717
  9. Authors observed thousands of unique HPV16 genomes; very few women shared the identical HPV16 sequence, however, E7 was devoid of variants in precancers/cancers compared to higher levels in the controls; this was confirmed in cancers from around the world. Strict conservation of the 98 amino acids of E7, which disrupts Rb function, is critical for HPV16 carcinogenesis. PMID: 28886384
  10. study determined that high-risk E7 proteins target the proteolysis of the cellular protein tyrosine phosphatase PTPN14 and find that this activity is correlated with the retinoblastoma-independent transforming activity of E7 PMID: 27651363
  11. Increased phosphorylation of the N29S of E7 increases interaction with TBP and pRb and viral transforming activity. PMID: 27829177
  12. HPV16 E7 oncoprotein upregulates Oct3/4, Sox2, Nanog and Fgf4 expression to maintain the self-renewal capacity of cancer stem cells. PMID: 27693927
  13. result indicates that cervical cancers do not require the continuous expression of E7 on the Fanconi anemia pathway-deficient background PMID: 27190216
  14. the level of Cdc6 phosphorylation at serine 54 (S54P) was increased in E7-expressing cells. S54P was associated with an increase in the total amount of Cdc6 and chromatin-bound Cdc6. DNA damage-enhanced upregulation and chromatin binding of Cdc6 appeared to be due to downregulation of cyclin-dependent kinase 1 (Cdk1) as Cdk1 knockdown increased Cdc6 levels PMID: 27207654
  15. PTPN14 is classified as a potential tumor suppressor protein, and is very susceptible to HPV E7-induced proteasome-mediated degradation. PMID: 28100625
  16. study found that HPV-16 decreased the phosphorylation of AKT (pAKT) and that this is a function of E7 that is independent of the Rb degradation function PMID: 27030265
  17. These data suggest that the HPV16 E7 oncoprotein impairs the function and morphology of dendritic cells and induces the systemic accumulation of CD11b(+)Gr1(+) cells. PMID: 27478837
  18. the structural features of the flexible N-terminal region (46 residues) of E7, were investigated. PMID: 27418281
  19. The human papillomavirus type 16 oncogene E7 may affect STK31 expression through a DNA methylation-mediated mechanism. PMID: 27044426
  20. HPV16 E7 protein can up-regulate host miR-21 expression, thus elevating cervical carcinoma cell growth, proliferation and invasion. PMID: 26884851
  21. These data suggest that local expression of HPV16-E7 in keratinocytes can contribute to persisting infection with this oncogenic virus, by altering the phenotype and function of local APCs. PMID: 27031095
  22. Results found that HPV16 E7 increases RARB mRNA and protein expression both in vitro and in the cervix of young K14E7 transgenic mice suggesting that RARB overexpression is part of the early molecular events induced by the E7 oncoprotein. PMID: 26173416
  23. E7 localised to the plasma membrane in cervical cancer cells. PMID: 26131956
  24. findings suggest that increased IL-17A expression by macrophages in E7-expressing skin exposed to DNCB promotes arginase-1 induction and contributes directly to the observed hyperinflammation. PMID: 25720383
  25. the modulation of HPV-16 E6/E7 expression remarkably influenced cell proliferation, migration, and invasion, as well as the protein levels of E-cadherin and P-cadherin in cervical cell lines. PMID: 26093522
  26. The data showed that E7 induced CCNA1 methylation by forming a complex with Dnmt1 at the CCNA1 promoter, resulting in the subsequent reduction of expression in cancers. PMID: 26250467
  27. In 10 microg/ml BV-treated CaSki cells, the mRNA expression and protein levels of HPV16 E7 were significantly decreased. The mRNA and protein expression levels of HPV16 E7 were decreased by bee venom in TC-1 tumors. PMID: 25633640
  28. that mast cells, recruited towards CCL2 and CCL5 expressed by epithelium induced to proliferate by Human Papillomavirus 16 E7 protein PMID: 25340820
  29. These results point to a mutually functional interaction between p14ARF and E7 that might partly explain why the sustained p14ARF expression observed in most cervical pre-malignant lesions and malignancies may be ineffective. PMID: 24798431
  30. In genetically engineered mouse models expressing HPV16 oncogenes in stratified squamous epithelia, HPV16 E7, alone or together with E6, led to an accumulation of epithelial cells harboring gamma-H2AX nuclear foci. PMID: 25216575
  31. Data indicate that HPV16E7, CBP/p300, and retinoblastoma protein pRb interactions are potentially important for cellular transformation. PMID: 25451029
  32. Our results demonstrate that HPV16.E7 protein enhances drug associated production of arginase-1 by myeloid cells and consequent inflammatory cellular infiltration of skin. PMID: 24732401
  33. The aim of the present study was to investigate the cytotoxicity of natural killer (NK) cells to CaSki cells following knockdown of the E7 protein of the human papillomavirus type 16. PMID: 24566606
  34. Results show that E7 interacts with the B-Myb, FoxM1 and LIN9 components of this activator complex, leading to cooperative transcriptional activation of mitotic genes in primary cells and E7 recruitment to the corresponding promoters. PMID: 24141769
  35. E7 induces cancer by causing DNA damage at least in part through the inactivation of pocket proteins. PMID: 24013229
  36. E7 induces human papillomavirus-associated head and neck cancers by promoting DNA damage through the inactivation of pocket proteins. PMID: 24086435
  37. HPV16 E7 oncoprotein increases production of the IL18BP in keratinocytes. PMID: 24478434
  38. The seven cysteines in HPV16 E7 remain reduced in conditions resembling the basal reduced state of a cell. PMID: 24559112
  39. This study demonstrates that the cdk inhibitor p16INK4A is required for high-level expression of the E7 oncoproteins of HPV-16, HPV-18, and HPV-45 in cervical carcinoma cells. PMID: 24599991
  40. These data suggest that the interaction of human papillomavirus E7 with p190 dysregulates this GTPase activating protein and alters the actin cytoskeleton. PMID: 24403595
  41. Matrix metalloproteinases (MMP)--MMP-1,-2,-9 and its endogenous activity regulators in transformed by E7 oncogene HPV16 and HPV18 cervical carcinoma cell lines PMID: 24479343
  42. E7 proteins of different types of human papillomaviruses disrupted pocket protein-DREAM complexes in a similar extent. PMID: 24294959
  43. hTERT cooperates with HPV16 E7 protein in mediating bypass of the senescence blockade and effecting cell immortalization PMID: 23592995
  44. Human papillomavirus type 16 E7 expression causes increased EMI1 mRNA expression and also inhibits EMI1 degradation. PMID: 24074588
  45. that a patch of hydrophobic residues, 65LRLCV69, within the zinc-binding domain of HPV16 E7 mediates its nuclear import via hydrophobic interactions with the FG domain of the central channel nucleoporin Nup62. PMID: 24074597
  46. HPV16-induced TLR9 down-regulation affects the interferon response which negatively regulates viral infection PMID: 23752229
  47. Authors investigated the effect of E7 on the late promoter and found that E7 was able to activate the promoter. PMID: 23725693
  48. expression of a single oncoprotein in the epidermis is sufficient for lymphocyte trafficking (including immunosuppressive lymphocytes) to premalignant skin PMID: 23469070
  49. Human papillomavirus 16 E7 Adenine647Guanine can be used as a candidate marker for the progression of the cervical neoplasia. PMID: 21535311
  50. These results demonstrate an important role for Cdt1 in human papillomavirus E7-induced rereplication and shed light on mechanisms by which human papillomavirus induces genomic instability. PMID: 23152514
  51. the E7 oncoprotein altered the transcriptional pattern of genes involved in several biological processes including signal transduction, transport, metabolic process, cell adhesion, apoptosis, cell differentiation, immune response and inflammatory response PMID: 22980503
  52. Data indicate that maintained AKT1 expression correlated with low copy number, an increased frequency of integration and increased HPV16 E7 expression. PMID: 22685591
  53. Importantly, however, HPV16 E7 does not markedly compromise the mitotic spindle assembly checkpoint response. PMID: 22748180
  54. Data showed that E7 soluble oligomers (E7SOs)/ODN vaccination significantly delays tumor growth and extends the time of survival of the treated mice in a dose-dependent manner. PMID: 21780110
  55. study demonstrate that HPV-16 E7 forms a complex with Miz-1; These findings suggest that HPV-16 E7 protein can repress Miz-1-induced p21(Cip1) gene expression PMID: 22099967
  56. A new isoform, MLL5beta, truncated in exon 14, regulates E7 transcription in HPV-16-positive cervical carcinoma cells. PMID: 21908553
  57. The results show that continued human papillomavirus 16 E6/E7 expression is necessary in cervical cancer cells to prevent cell-cycle arrest by a repressive p130-DREAM complex. PMID: 21813705
  58. These results identify several novel E7 mutants that abrogate transformation and also indicate that E7 does not need to exist as a stable dimer in order to transform cells. PMID: 21775462
  59. HPV16 E7, via the activation of the cyclin-dependent kinase complexes, promoted the accumulation of a phosphorylated form of NHERF-1, which is preferentially targeted by E6. PMID: 21680517
  60. CIP2A protein level was positively associated with HPV16 E7 level in cervical cancer tissues PMID: 21575984
  61. Genetic diversity of HPV-16 E7 gene is associated with cervical lesions. PMID: 21436703
  62. Our study showed that knockdown of HPV16 E7 could increase cell surface HLA class I antigen expression in HaCaT-E7 cells. PMID: 21330828
  63. Data show that the binding of scFv 43M2 to E7 was inhibited by pRb in a non-competitive manner. PMID: 21241471
  64. expression of HPV 16 E7 protein in keratinocytes may inhibit enhancement by IFN-gamma of KC sensitivity to T-cell lysis, by impairing antigen presentation. PMID: 21232015
  65. Data sshow that K14E7/FancD2(-/-) mice had a significantly higher incidence of HNSCC compared with K14E7/FancD2(+/+) mice. PMID: 20935219
  66. Results indicate that HPV-16 oncoprotein E7 binds to the C-terminus of TIEG1 and induces its degradation via the ubiquitin pathway. E7 not only increased the ubiquitination of TIEG1 but also influenced the ability of TIEG1 to affect apoptosis. PMID: 20691807
  67. We demonstrate for the first time that the HPV-16 E7 oncoprotein is abundantly expressed in cervical adenocarcinoma in situ and adenocarcinoma, suggesting an important role of HPV-16 E7 for the development of these tumors. PMID: 20970819
  68. Sirtuin 1 mediates human papillomavirus E7 survival function in SiHa cervical cancer cells. HPV E7 up-regulates SIRT1 protein when expressed in primary human keratinocytes. SIRT1 levels decrease following RNAi-mediated silencing of HPV E7 in SiHa cells. PMID: 20157519
  69. HPV-16 E7 down-regulates surface HLA class I antigen, which in part correlates with the decrease of TAP-1. PMID: 20134267
  70. E7-induced TNF resistance correlates with its ability to mediate pRb degradation and cell transformation. This effect does not depend on E7 sequences required to override DNA damage-induced cell cycle arrest or extend keratinocyte life span. PMID: 20042637
  71. HPV-16 E5 and E6/E7 increase chemotaxic and invasive properties of trophoblastic cells. HPV-16 E5 participated, with E6 and E7, in these changes by impairing E-cadherin expression. E7, favoring cell growth, neutralized the E5 cytotoxic effect. PMID: 19917629
  72. Human papillomavirus-16 E7 interacts with glutathione S-transferase P1 and enhances its role in cell survival PMID: 19826491
  73. mature thymocytes that would normally die in the thymus gradually accumulated in E7 transgenic animals PMID: 14768939
  74. Expression of HPV16 E7 variants contributes to persistence of HPV-related cervical cancer in Hubei province of China PMID: 15112580
  75. E7-driven degradation of pRb may be involved in cervical tumorigenesis in humans. PMID: 15155561
  76. in human foreskin keratinocytes, HPV16 E7 increased acetylation of histone H3 on lysine 9, which is related to transcription activation PMID: 15476886
  77. HLA-B8-presented HPV16 E7 epitope is recognized by T cells from patients with cervical cancer PMID: 15609316
  78. data demonstrate that the E7 proteins of the high-risk HPV types 16 and 8 lead to the induction of MT-1 MMP; this E7-mediated mechanism may profoundly alter the phenotype of infected keratinocytes PMID: 15831939
  79. Results suggest that the functional activity and sequence variations of HPV 16 upstream regulatory region may not be related to the oncogenic potential of HPV 16 E7 variants. PMID: 16012730
  80. C/EBPbeta is involved in enhancing transcription from the P670 during keratinocyte differentiation. PMID: 16307770
  81. determination of the retinoblastoma binding protein binding affinity of E7 proteins and analysis of their impact on the Rb protein pathway in intact cells. PMID: 16350411
  82. shared activity of HPV-16 E7 and HPV-6 E7 to destabilize p130 and decrease or delay differentiation may be related to the role of E7 in the HPV life cycle PMID: 16381817
  83. These results demonstrate a direct role for E2 in regulating the function of E7 and suggest an important role for E2 in directing E7 localization during mitosis. PMID: 16439535
  84. demonstrates a strategy for overcoming inhibition of MHC class I epitopes upon immunization of a host already primed to antigen, which may facilitate immunotherapy for chronic viral infection or cancer PMID: 16920922
  85. The interaction of FHL2 with HPV-16 E7 leads to a promoter-specific impairment of FHL2 function and this may contribute to cell transformation. PMID: 17093190
  86. Impairment of the multifunctional role of Nm23-H1 is an important feature consistent with the complex strategy carried out by HPV-16 E7 to promote cell transformation and tumor progression. PMID: 17103045
  87. results revealed that HaCaT keratinocytes infected with HPV 16 E7 oncogene modulated expressions of catalase, Bcl-xL, IL-18, Fas, Bad, and cytochrome c as well as NF-kappaB, resulting in the resistance to oxidative stress-induced cell death PMID: 17334903
  88. Confirming the anti-apoptotic role of HPV-16 E7 in the HaCaT cellular model, evaluated by nuclear morphology, it was also found that Siva-1 expression produced a significant increase of the apoptotic rate in UV radiation-exposed HaCaT cells. PMID: 17348035
  89. E7 protein contributes not only to the uncontrolled keratinocyte growth seen following HPV infection but also to the angiogenic response needed for tumor formation. PMID: 17602722
  90. The intrinsically disordered properties of the N-terminal module of E7 are responsible for the structural plasticity of the oncoprotein. PMID: 17715947
  91. E7-mediated destruction of nuclear IGFBP-3 correlates with the inhibition of IGFBP-3-induced apoptotic cell death. PMID: 17827406
  92. Study found that Fanconi anemia pathway activation is triggered mainly by the HPV type 16 (HPV-16) E7 oncoprotein and is associated with an enhanced formation of large FANCD2 foci and recruitment of FANCD2 as well as FANCD1/BRCA2 to chromatin. PMID: 17898070
  93. results suggest that the association with gamma-tubulin contributes to the pRb/p107/p130-independent ability of HPV16 E7 to subvert centrosome homeostasis PMID: 17913829
  94. The data strongly suggest that CDP acts as a major suppressor for Human papillomavirus type 16 P670 transcription by binding to the promoter region in the undifferentiated cells PMID: 17957475
  95. the point mutation in the E7 oncogene, which resulted in the N53S substitution in the immunodominant epitope RAHYNIVTF (aa 49-57)eliminated immunogenicity of E7 PMID: 17962940
  96. Results suggest that DYRK1A increases the transforming potential of HPV16-infected cells because of the greater stability of HPV16E7. PMID: 18468476
  97. target DNA vaccine can induce an E7-specific CTL response, which is important in the lysis of infected tumor cells PMID: 18523353
  98. transgenic mice develop thyroid hyperplasia followed by solid differentiated carcinoma in older animals PMID: 18583418
  99. up-regulation of transcription in human herpesvirus-8 ORF50 transfected cells PMID: 18607925
  100. HPV type 16 E7 proteins associated with most cervical cancer incidence and HDAC inhibitors such as apiciidn are being tested in anti-cancer clinical trials. PMID: 18687520

Show More

Hide All

Subcellular Location Host cytoplasm, Host nucleus
Protein Families Papillomaviridae E7 protein family
Database Links

KEGG: vg:1489079

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1