Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
| Code | CSB-EP365855HML |
| Size | $1812 |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
| Description |
The product is an E.coli-expressed Recombinant Human papillomavirus (HPV)type 16 Protein E7(E7). It contains a full length-amino acid sequence from Met1 to Pro98 and carries 6xHis-tags at the N-terminus. The calculated molecular mass of this E7 protein is 15.0 kDa. It has high purity, greater than 90% as determined by SDS-PAGE. This recombinant E7 protein can be used as an immunogen for antibody products and find studies in epigenetics and nuclear signaling as well as cervical cancer. The HPV 16 E7 protein is constitutively expressed in HPV-positive cervical cancers, almost 98% of which are associated with the high-risk types of HPVs. E7-pRB interaction destroys the binding of pRB-E2F repressor complex, triggering uncontrolled cell cycle progression. That is, it reprograms the cellular environment allowing it conducive to viral replication, thereby exerting a crucial role in the life cycle of human papillomavirus. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Target Names | E7 |
| Uniprot No. | P03129 |
| Research Area | Epigenetics and Nuclear Signaling |
| Alternative Names |
E7; Protein E7
|
| Species | Human papillomavirus type 16 |
| Source | E.coli |
| Expression Region | 1-98aa |
| Target Protein Sequence | MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 15.0 kDa |
| Protein Length | Full Length |
| Tag Info |
N-terminal 6xHis-tagged |
| Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | 3-7 business days |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Would you have the recipe for the Tris buffer that you could share? If not, the recipe can you share the molarity and the pH of the Tris buffer?
| Function |
Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Plays also a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta).
|
| Gene References into Functions |
|
| Subcellular Location | Host cytoplasm. Host nucleus. |
| Protein Families | Papillomaviridae E7 protein family |
| Database Links |
KEGG: vg:1489079 |
