Recombinant Macaca fascicularis Thymic stromal lymphopoietin (TSLP), Biotinylated (Active)

In Stock
Code CSB-MP5042MOVd7-B
Abbreviation Recombinant Cynomolgus monkey TSLP protein, Biotinylated (Active)
MSDS
Size $166
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    ①Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TSLP at 2 μg/ml on streptavidin coated plates can bind Macaca fascicularis CRLF2 protein(CSB-MP5357MOV). The EC50 is 2.698-3.710 ng/mL. Biological Activity Assay
  • Activity
    ②Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TSLP at 2 μg/ml on streptavidin coated plates can bind Anti-TSLP recombinant antibody(CSB-RA025141MA2HU). The EC50 is 11.71-21.61 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TSLP at 2 μg/mL on streptavidin coated plates can bind Macaca fascicularis CRLF2 protein(CSB-MP5357MOV). The EC50 is 2.698-3.710 ng/mL.
②Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TSLP at 2 μg/mL on streptavidin coated plates can bind Anti-TSLP recombinant antibody(CSB-RA025141MA2HU). The EC50 is 11.71-21.61 ng/mL.
Target Names
Uniprot No.
Alternative Names
Thymic stromal lymphopoietin; TSLP
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Mammalian cell
Expression Region
29-159aa
Target Protein Sequence
YDFTNCDFQKIEADYLRTISKDLITYMSGTKSTDFNNTVSCSNRPHCLTEIQSLTFNPTPRCASLAKEMFARKTKATLALWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLLGLWRRFIRTLLKKQ
Mol. Weight
18.7 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-Avi-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

TSLP initiates type 2 immune responses by engaging a heterodimeric receptor complex, making quantitative assessment of receptor binding essential for modeling allergic inflammation and epithelial–immune crosstalk. This biotinylated cynomolgus macaque TSLP, spanning the full mature sequence (aa 29–159), demonstrates robust binding to its cognate receptor CRLF2 with an EC50 of 2.698–3.710 ng/mL in functional ELISA, providing a quantitative benchmark for cell-based activation assays using primary dendritic cells or PBMC to study Th2 polarization and cytokine secretion profiles. The protein also binds an anti-TSLP monoclonal antibody with an EC50 of 11.71–21.61 ng/mL, supporting its use as a coating antigen in antibody development workflows and as a positive control in ELISA or Western blot validation of TSLP detection reagents. With endotoxin levels below 1.0 EU/μg and purity exceeding 90%, this preparation meets the quality thresholds commonly required for immune cell functional assays where LPS contamination would confound interpretation of TSLP-driven signaling through JAK/STAT pathways.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*