Recombinant Macaca mulatta (Rhesus macaque) Interleukin-1 alpha(IL1A)

Code CSB-EP011613MOW
Product Type Recombinant Protein
Size US$2466
Uniprot No. P48089
Relevance Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Hematopoietin-1
Species Macaca mulatta (Rhesus macaque)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SAPFSFLSNMTYHFIRIIKHEFILNDTLNQTIIRANDQHLTAAAIHNLDEAVKFDMGAYTSSKDDTKVPVILRISKTQLYVSAQDEDQPVLLKEMPEINKTITGSETNFLFFWETHGTKNYFISVAHPNLFIATKHDNWVCLAKGLPSITDFQILENQA
Research Area Others
Source E.coli
Gene Names IL1A
Protein Names Recommended name: Interleukin-1 alpha Short name= IL-1 alpha Alternative name(s): Hematopoietin-1
Expression Region 113-271aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 34.1kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Subcellular Location Secreted
Protein Families IL-1 family
Database Links

KEGG: mcc:700193

STRING: 9544.ENSMMUP00000026006

UniGene: Mmu.3361

Pathway MAPK signaling pathway
Necroptosis
Cellular senescence
Hematopoietic cell lineage
Osteoclast differentiation
AGE-RAGE signaling pathway in diabetic complications

Related Products

IL1A Antibodies

IL1A Antibodies for Macaca mulatta

IL1A Antibodies for Macaca mulatta (Rhesus macaque)

IL1A Proteins

IL1A Proteins for Macaca mulatta (Rhesus macaque)

IL1A ELISA Kit

IL1A ELISA Kit for Monkey

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.