Recombinant Mouse Angiopoietin-2 (Angpt2), partial

Code CSB-RP169594m
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Angpt2
Uniprot No.
Research Area
Others
Alternative Names
Angpt2; Agpt2Angiopoietin-2; ANG-2
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
19-483aa
Target Protein Sequence
YSNFRKSVDSTGRRQYQVQNGPCSYTFLLPETDSCRSSSSPYMSNAVQRDAPLDYDDSVQRLQVLENILENNTQWLMKLENYIQDNMKKEMVEIQQNVVQNQTAVMIEIGTSLLNQTAAQTRKLTDVEAQVLNQTTRLELQLLQHSISTNKLEKQILDQTSEINKLQNKNSFLEQKVLDMEGKHSEQLQSMKEQKDELQVLVSKQSSVIDELEKKLVTATVNNSLLQKQQHDLMETVNSLLTMMSSPNSKSSVAIRKEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
57.0kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds to TEK/TIE2, competing for the ANGPT1 binding site, and modulating ANGPT1 signaling. Can induce tyrosine phosphorylation of TEK/TIE2 in the absence of ANGPT1. In the absence of angiogenic inducers, such as VEGF, ANGPT2-mediated loosening of cell-matrix contacts may induce endothelial cell apoptosis with consequent vascular regression. In concert with VEGF, it may facilitate endothelial cell migration and proliferation, thus serving as a permissive angiogenic signal.
Gene References into Functions
  1. Flunarizine protected ECs from TNFalpha-induced increase in Angpt-2 transcription and vascular barrier breakdown. PMID: 28276491
  2. At the molecular level NLGN2 colocalizes with its neuronal partner collibystin, a CDC42 guanine nucleotide exchange factor, which is also expressed by endothelial cells and in turn modulates Angiopoietin 2 release. PMID: 29709479
  3. ANGPT2-TIE2 signaling is essential for mesenteric lymphatic development.VEPTP (vascular endothelial protein tyrosine phosphatase) determines TIE2 response to ANGPT2. PMID: 29358379
  4. Endothelial glycocalyx breakdown is mediated by Angpt-2 in a non-redundant manner. PMID: 28453727
  5. These results indicate that the Angpt-Tie2 system is essential for SC integrity. The impairment of this system underlies POAG-associated pathogenesis, supporting the possibility that Tie2 agonists could be a therapeutic option for glaucoma. PMID: 28920924
  6. ANG2 activation of Tie2 supports stable enlargement of normal nonleaky vessels, but reduction of Tie1 in inflammation leads to ANG2 antagonism of Tie2 and initiates a positive feedback loop wherein FOXO1-driven ANG2 expression promotes vascular remodeling and leakage PMID: 27548529
  7. A balanced expression of the Ang1/Ang2 system is important for islet physiology. Ang-2 prevents beta-cell mass and islet vascular adaptation in response to HFD feeding with no major influence on glucose homeostasis PMID: 27617438
  8. These results underscore a pivotal role of Kaposi's sarcoma-associated herpesvirus -induced Ang-2 in KS tumor development by promoting both angiogenesis and inflammation. PMID: 27294705
  9. NDPKB is a protective factor in the retina, which controls Ang2 expression and the hexosamine pathway. PMID: 25900369
  10. miR-150 is a novel suppressor of Ang2 generation with a key role in resolving vascular injury and reducing mortality resulting from sepsis. PMID: 26743170
  11. Ang-2 blockage was beneficial as it decreased fatty streak formation and plasma triglyceride levels, but had no adverse effect on pre-existing atherosclerosis in hypercholesterolemic mice. PMID: 26062989
  12. The results establish Ang2-mediated beta1-integrin activation as a promoter of endothelial destablization, explaining the controversial vascular functions of Ang1 and Ang2. PMID: 25635707
  13. Alprostadil treatment can protect renal function by reducing proteinuria. These effects are mediated, at least in part, through down-regulation of Ang-2 and IL-18 expression PMID: 25200363
  14. ANG2 as the first essential regulator of the functionally important interendothelial cell-cell junctions that form during lymphatic development PMID: 25030698
  15. This study identifies angiopoietin-2 as a link between kidney fibrosis and arterial stiffness. PMID: 24511140
  16. vitamin D-VDR signaling prevents lung injury by blocking the Ang-2-Tie-2-MLC kinase cascade and the renin-angiotensin system. PMID: 24196349
  17. Angiopoietin-2 was expressed on lymphatic vessels and macrophages in inflamed cornea. While corneal LG response was abolished in Ang-2 knockout mice. PMID: 24781940
  18. The Ang-1, Ang-2, Tie-2 system takes part in the pathologic processes in the brains that suffered acute carbon monoxide poisoning by participating in neovascularization. PMID: 23424209
  19. Anti-angiogenic miR-542-3p directly targets the key angiogenesis-promoting protein Angpt2 to prevent tumor angiogensis. PMID: 24403060
  20. Data report here in a definite genetic setting that Ang-2 is critical for multiple vascular permeability-inducing cytokines. PMID: 23940579
  21. Ang-2 is involved in initial steps of the triple-negative breast cancer brain metastasis cascade PMID: 24421076
  22. The data establish liver sinusoidal endothelial cells (LSECs) as a dynamic rheostat of liver regeneration, spatiotemporally orchestrating hepatocyte and LSEC proliferation through angiocrine- and autocrine-acting Ang2, respectively. PMID: 24458641
  23. Myocardial upregulation of angiopoietin 2 is attenuated following thrombospondin-1 disruption. PMID: 24081879
  24. angiopoietin-2 deficiency do not protect mice against endotoxin-induced acute kidney injury. PMID: 22872727
  25. a protective role of Ang2 following cerebral ischemia, an action associated with a reduced BBB permeability. PMID: 23211963
  26. LRP5-Tie2-Ang signaling axis plays a central role in control of both angiogenesis and alveolarization during postnatal lung development PMID: 22848540
  27. Ang-2 may be involved in follicular development, atresia, ovulation, and corpus luteum formation and regression. PMID: 23350236
  28. During liver colonization showed, colony growth and neo-angiogenesis were strongly affected by host Ang2, specifically, larger tumor volume, higher vascular density and pericyte coverage development in its absence. PMID: 22699974
  29. a contextual model whereby differential TIE2 and integrin expression, binding, and activation control the role of ANG-2 in angiogenesis. PMID: 22585576
  30. Studies indicate an important role of Ang2 in pancreatic vascular defects induced by hyperglycaemia. PMID: 22272235
  31. In addition to its role during setup of the brain vasculature, Ang2 is also involved in embryonic cortical neurogenesis and in the radial migration of projection neurons. PMID: 21127017
  32. Results indicate that blocking Ang2 inhibits metastatic dissemination in part by enhancing the integrity of endothelial cell-cell junctions. PMID: 22343031
  33. Ang-2 acts as a crucial regulator of inflammatory lymphangiogenesis by sensitizing the lymphatic vasculature to inflammatory stimuli, thereby directly promoting lymphangiogenesis. PMID: 22058148
  34. Studies suggest that the combined targeting of angiogenic ECs and proangiogenic TEMs by selective ANG2/TIE2-pathway inhibitors may extend the reach of vascular-targeting therapies in cancer patients. PMID: 21576085
  35. human Ang2 antibodies are potentially therapeutic agents for ocular neovascularization in models of retinal and choroidal neovascularization, in the absence of VEGF inhibition. PMID: 21851472
  36. Ang-2 is a novel, endothelial-derived regulator of myeloid cell infiltration that modulates beta-integrin-mediated adhesion in a paracrine manner. PMID: 21868579
  37. In cultured brain endothelial cells exposed to hypoxia,expression of Ang-2, MMP2 and caspase 3 were elevated. PMID: 21904637
  38. results showed Ang-2-transfected tumours displayed aberrant angiogenic vessels with few associated smooth muscle cells. No detectable differences in VEGF expression were observed between Ang-2-transfected and parental tumours. PMID: 21163623
  39. Ang-1 treatment downregulates pulmonary inflammation, VEGF and Ang-2 expression but does not protect against vascular leakage and impaired gas exchange induced by HVT-ventilation PMID: 21179479
  40. Ang-2 exacerbated mouse heart myocardial endothelial cells dysfunction induced by high glucose condition. PMID: 21113176
  41. increased expression of Tie2 and Ang2 in allergic airway epithelium and alveolar macrophages, but not Ang1 or VEGF correlates with the severity of airway remodeling PMID: 20463289
  42. Ang2 acting as an antagonist of Tie2 receptors and the reduction of Tie2 phosphorylation in endothelial cells rendering the vasculature more responsive to cytokines that promote both vascular remodeling and inflammation after M. pulmonis infection. PMID: 20952594
  43. Angiopoietin 2 mediates inflammatory hemangiogenesis, lymphangiogenesis and neutrophil infiltration in dextran sodium sulfate-induced colitis. PMID: 19902545
  44. Findings provide evidence that the inflammatory cytokine oncostatin M is involved in modulation of the Ang-Tie system by increasing Ang2 expression in human endothelial cells in vitro, and in murine hearts and human hearts in vivo. PMID: 20088942
  45. Data suggest that inhibition of Angiopoietin 2 leads to normalization of tumor blood vessels by permitting the unopposed action of Ang1, but decreases tumor vascularity primarily by blocking Ang2 actions. PMID: 19815705
  46. data show that tumor cell aggregates initiate vascular growth by angiogenic sprouting via the simultaneous expression of VEGFR-2 and Ang-2 by host and tumor endothelium PMID: 11901186
  47. Orchestrates angiogenesis and arteriovenous contribution PMID: 12048246
  48. Angiopoietin-2 plays an important role in retinal angiogenesis PMID: 12115724
  49. Ang2 signals are required for the proper development and function of the lymphatic vessels. PMID: 12361591
  50. Angiopoetin 2 is required for postnatal angiogenesis and lymphatic patterning. PMID: 12361603

Show More

Hide All

Subcellular Location
Secreted.
Tissue Specificity
Expressed only at sites of vascular remodeling.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*