Recombinant Mouse C-X-C motif chemokine 11 (Scyb11), partial

Code CSB-RP092874m
Abbreviation Recombinant Mouse Scyb11 protein, partial
MSDS
Size US$306
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Cxcl11; Scyb11C-X-C motif chemokine 11; Interferon-inducible T-cell alpha chemoattractant; I-TAC; Small-inducible cytokine B11
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
22-98aa
Target Protein Sequence
FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
12.9kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses.
Gene References into Functions
  1. although the expression of CXCL9 and CXCL11 are increased after spinal nerve ligation, they may not contribute to the maintenance of neuropathic pain. PMID: 29712506
  2. These findings functionally integrate K17, hnRNP K, and gene expression along with RSK and CXCR3 signaling in a keratinocyte-autonomous axis and provide a potential basis for their implication in tumorigenesis PMID: 25713416
  3. very low doses of CXCL11 rapidly suppress signs of EAE in C57BL/6 mice lacking functional CXCL11. PMID: 24713654
  4. Data indicate that epidermis-derived I-TAC (Cxcl11) triggers a sustained Th2-response that determines the outcome of a complex immunological process. PMID: 24398292
  5. Analysis of genes within the Listr1 locus identified a frameshift mutation in the Cxcl11 gene of the C57BL/6 strain that prevents production of the mature chemokine CXCL11. PMID: 24566892
  6. Cxcl10 and cxcl11 are new hair-specific transcriptional targets of ectodysplasin, and they indicates involvement of chemokines in hair development. PMID: 22277947
  7. the CXCL11-heparin interaction has two different affinities for glycosaminoglycans PMID: 20363748
  8. I-TAC can have an important role during virus infections and vaccinia virus has evolved ways to avoid inducing I-TAC expression. PMID: 15030574
  9. I-TAC acts as an antagonist for CCR5. I-TAC inhibited the binding of macrophage-inflammatory protein-1alpha (MIP-1alpha)/CC chemokine ligand 3 (CCL3) to cells transfected with CCR5 and to monocytes. PMID: 15178708
  10. Acute ethanol intoxication impairs lung expression of Cxcl11, interfering with pulmonary response to bacterial challenge. PMID: 17889309
  11. homologous to human T cell attracting chemokine CXC receptor ligand 11; involved in calcium mobilization and chemotaxis PMID: 11500837

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Intercrine alpha (chemokine CxC) family
Database Links

KEGG: mmu:56066

UniGene: Mm.131723

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*