Tel : 301-363-4651 Professional and Accurate! We are your good partner in biology research.

Product Name:

Recombinant Mouse C-X-C motif chemokine 11(Scyb11),partial

Product Type : Recombinant Protein
Code : CSB-RP092874m
Size : Pls inquiry other sizes
Uniprot NO. : Q9JHH5
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Relevance : Chotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses .
Image :
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References : The murine chemokine CXCL11 (IFN-inducible T cell alpha chemoattractant) is an IFN-gamma- and lipopolysaccharide-inducible glucocorticoid-attenuated response gene expressed in lung and other tissues during endotoxemia.Widney D.P., Xia Y.-R., Lusis A.J., Smith J.B.J. Immunol. 164:6322-6331(2000)
Storage Buffer : Tris-based buffer,50% glycerol
Alias : Interferon-inducible T-cell alpha chemoattractant ;I-TACSmall-inducible cytokine B11
Species : Mus musculus (Mouse)
Purity : Greater than 90% as determined by SDS-PAGE.
Sequence : FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQ
Research Area : Others
Source : E.coli
Gene Names : Scyb11
Expression Region : 22-98aa
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info :
Mol. Weight : 12.9kDa
Protein Description : Partial
Contact us

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2015 www.cusabio.com Cusabio Biotech Co., Ltd All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.