Recombinant Mouse CD40 ligand (Cd40lg), partial

In Stock
Code CSB-YP004937MO1
Abbreviation Recombinant Mouse Cd40lg protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
CD40-L;T-cell antigen Gp39;TNF-related activation protein(TRAP);Tumor necrosis factor ligand superfamily member 5
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
112-260aa
Target Protein Sequence
MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
42.1 kDa
Protein Length
Partial
Tag Info
N-terminal mFc1-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cytokine that acts as a ligand to CD40/TNFRSF5. Costimulates T-cell proliferation and cytokine production. Its cross-linking on T-cells generates a costimulatory signal which enhances the production of IL4 and IL10 in conjunction with the TCR/CD3 ligation and CD28 costimulation. Induces the activation of NF-kappa-B. Induces the activation of kinases MAPK8 and PAK2 in T-cells. Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL4. Involved in immunoglobulin class switching.; Acts as a ligand for integrins, specifically ITGA5:ITGB1 and ITGAV:ITGB3; both integrins and the CD40 receptor are required for activation of CD40-CD40LG signaling, which have cell-type dependent effects, such as B-cell activation, NF-kappa-B signaling and anti-apoptotic signaling.
Gene References into Functions
  1. These results suggest that combination of IL-21, anti-Tim1 and CD40L treatment induced B10 cell's IL-10 competency in vitro and inhibited periodontal bone loss in ligature-induced experimental periodontitis. PMID: 28583714
  2. MR1-induced bone accrual was associated with increased Treg development and elevated production of cytotoxic T lymphocyte antigen 4, a costimulation inhibitor that promotes T cell anergy and CD8+ T cell expression of the bone anabolic ligand Wnt-10b. PMID: 29522194
  3. Soluble CD40 ligand directly alters glomerular permeability and may act as a circulating permeability factor in focal segmental glomerulosclerosis. PMID: 29155846
  4. studies identify a novel molecular mechanism of regulation of CD40L by the transcription factor GLI2 in the tumor microenvironment downstream of CCR3 signaling PMID: 28461568
  5. our results unambiguously demonstrate that while CD40L is critical to generate effective primary CD8(+) T-cell responses also under inflammatory conditions, CD40L expression by CD8(+) T cells themselves is dispensable in acute lymphocytic choriomeningitis virus infection. PMID: 27562840
  6. Platelets promote allergic asthma through the expression of CD154. PMID: 25418472
  7. CD40L does not play a functional role in experimental acute pancreatitis PMID: 21419763
  8. The tissue-specific, activation-dependent and reversible expression of CD40L fully mimics the physiological induction and disappearance of the molecule from the surface of murine T lymphocytes. PMID: 26223487
  9. Report targeting and liposomal drug delivery of methotrexate to CD40L expressing T cells for treatment of autoimmune diseases. PMID: 25839125
  10. PU.1 Expression in T Follicular Helper Cells Limits CD40L-Dependent Germinal Center B Cell Development. PMID: 26363052
  11. CD154 expression by CD4 T cells is required for the priming memory CD8 T cells that are capable of fully responding to secondary infection. PMID: 24777309
  12. data show that vaccination with TAA/CD40L DNA can induce potent antitumor effects against TAA-expressing tumors through the generation of better functioning antigen-specific CD8+ T cells. PMID: 24664420
  13. findings indicate that targeting Rac1 signaling might be a useful way to control pathologic elevations of CD40L in the systemic circulation in abdominal sepsis PMID: 25046439
  14. Data indicate that a single dose of adenoviral vectors secreting nucleoprotein (NP)-CD40L fusion protein (rAd-SNP40L) completely protected mice from lethal viral challenge 4 mo after immunization. PMID: 24928989
  15. expression of CD40L in an earlier developmental step may be determinant in the regulation of the class switch recombination process PMID: 24030045
  16. Key contributions of CD40L and IFNG signaling in the antitumor responses triggered in vivo by B-Raf(V600E) inhibitors. PMID: 24736544
  17. many ATII-induced effects on vascular dysfunction, such as vascular inflammation, oxidative stress and a pro-thrombotic state, are mediated at least in part via CD40L. PMID: 24061433
  18. These data indicate that the ability of autoreactive CD4(+) T cells to undergo tolerance mediated by CD8(+) dendritic cells is defective in NOD mice and that blocking CD40-CD40L interactions can restore tolerance induction. PMID: 24082013
  19. Preexisting autoreactive T cells specific for cardiac myosins are important functional barriers to donor specific transfusion/anti-CD154 antibody induced prolongation of cardiac allograft survival in mice. PMID: 24056628
  20. in vivo biochemical or genetic inhibition of NFATc2 activity in megakaryocyte diminishes platelet CD40L implicates the NFATc2/EGR-1 axis as a key regulatory pathway of inflammatory and immunomodulatory activity in platelets PMID: 24106272
  21. Propose a role of MMP-9 in regulating platelet-dependent infiltration of neutrophils and tissue damage in septic lung injury by controlling CD40L shedding from platelets. PMID: 23617547
  22. Protein kinase C zeta is critically required for sCD40L-induced Mac-1 activation and neutrophil adhesive function. PMID: 23785403
  23. A major part of central and effector memory CD8(+) T cells expresses CD40L, one key molecule for CD4(+) T-cell-mediated help. PMID: 23719298
  24. Western blot analysis confirmed strong CD154 expression in the cultured cell line PC10, but not in LK2. We also assessed CD154 expression in SCID mouse xenografts of these cell lines. PMID: 23404288
  25. The HIV transactivator of transcription (Tat) can induce BBB permeability in a CD40L-dependent manner. PMID: 23251626
  26. a novel CD4(+) T cell-based vaccine that is capable of stimulating long-term functional CTL memory via CD40L signaling may represent a novel, efficient approach to antitumor vaccination. PMID: 23042534
  27. CD154 signaling of CD4+ T cells play a critical role in multiple phases of CD8+ cytotoxic T lymphocytes responses following adenovirus vaccination. PMID: 23071696
  28. CD40L signaling controls proliferation, but not the rate of apoptosis, within the mouse thymic epithelial cell compartment. PMID: 23152561
  29. We found that regulatory dendritic cell-derived IFN-beta and CD40 ligand are responsible for the differentiation of CD19(hi)FcgammaIIb(hi) B cells. PMID: 22692512
  30. Primed CD4-positive T cells represent crucial immune intermediates for rapid induction of responses and for functional memory via CD40L signaling. PMID: 22544940
  31. Demonstrate that short-term ex vivo exposure of primary naive CD4(+) T-cells to Staphylococcus enterotoxin A (SEA)induces differential expression of the T cell surface receptor CD154 in a time- and dose-dependent manner. PMID: 22067024
  32. This paper describes a novel role of metalloproteinases in regulating platelet-dependent activation and infiltration of neutrophils in septic lung injury which might be related to controlling CD40L shedding from platelets PMID: 22349180
  33. Excess CD40L efficiently blocked tolerance of Sm/RNP-reactive MZ B cells, leading to production of anti-Sm/RNP antibody implicated in the pathogenesis of lupus. PMID: 22547827
  34. Preformed CD40L may function in T cell development. PMID: 22363608
  35. Addition of CD40 signal to TLR agonists stimulated either B cell proliferation and activation (TLR3, TLR4, and TLR9) or differentiation into antibody-secreting cells. PMID: 21991317
  36. CD40-CD40L signaling plays a critical role during rescue of exhausted CD8 T cells in mice with chronic toxoplasmosis. PMID: 21949017
  37. CD40L binds to the EQLKKSKTL moti an exposed loop between the alpha1 helix and the beta-sheet B, f, on Mac-1 mediating leukocyte recruitment and atherogenesis. PMID: 21998326
  38. CD40L plays a crucial role in the development of obesity-induced inflammation and metabolic complications. PMID: 21817098
  39. Preformed CD40L mediates selective activation of cognate but not bystander anteigen presenting cells (APCs) in vitro. PMID: 21677130
  40. results do not support the idea that the CD40-CD40L interaction is involved in mediating transfusion-related acute lung injury PMID: 21605114
  41. cross-talk between T cells and SCs mediated by CD40L plays a pivotal role in the disregulation of osteoblastogenesis and osteoclastogenesis induced by ovx PMID: 21187391
  42. The control of the unfolded protein response by CD154 may represent one of the mechanisms involved in the pathophysiology of hepatic steatosis. PMID: 21064031
  43. Platelet CD40L plays a pivotal role in atherosclerosis. PMID: 20705757
  44. Data suggest that platelet CD154 potentiates interferon-alpha secretion by plasmacytoid dendritic cells in systemic lupus erythematosus. PMID: 20811042
  45. alloreactive CD4 T cells are capable of enhancing innate tissue inflammation and organ injury via an Ag-nonspecific CD154-dependent but IFN-gamma independent mechanism. PMID: 20659085
  46. The expression of CD40L in ovarian cancer cells can enhance the proliferation and differentiation of dendritic cells and induce specific cytotoxic effect of T cells in the spleen. PMID: 19950697
  47. Low levels of dendritic cell (DC) CD40 expression are required for efficient regulatory T cell generation; leishmanial antigen-pulsed DCs expressing high CD40 levels induce protection against Leishmania donovani challenge of host mice. PMID: 20525887
  48. Fusion of dendritic cells and tumor cells (FC) transduced with Adv-CD40L enhances the antitumor effect of FC vaccines in a murine lymphoma model and this is associated with an increased Th17-type immune response. PMID: 20010627
  49. data suggest that a lack of CD154/CD40 costimulation results in ineffective allospecific priming of CD8(+) T cells required for murine obliterative airway disease. PMID: 20021479
  50. Data show that CD154-transfected tumor cell/DC hybrids are a promising approach to increase the efficiency of antitumoral response. PMID: 19546834

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein. Cell surface.; [CD40 ligand, soluble form]: Secreted.
Protein Families
Tumor necrosis factor family
Tissue Specificity
Specifically expressed on activated CD4+ T-lymphocytes.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*