Recombinant Mouse Growth-regulated alpha protein (Cxcl1), partial

Code CSB-RP092174m
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Cxcl1
Uniprot No.
Research Area
Others
Alternative Names
Cxcl1; Gro; Gro1; Mgsa; Scyb1Growth-regulated alpha protein; C-X-C motif chemokine 1; Platelet-derived growth factor-inducible protein KC; Secretory protein N51) [Cleaved into: KC(5-72; Hematopoietic synergistic factor; HSF; KC-T)]
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
29-96aa
Target Protein Sequence
NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
11.5kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has chemotactic activity for neutrophils. Contributes to neutrophil activation during inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. KC(5-72) shows a highly enhanced hematopoietic activity.
Gene References into Functions
  1. Data suggest that CD4+ T lymphocytes and microglial CD40 mediate their pro-nociceptive effects in part by promoting selected chemokine responses, and more importantly, CXCL1 can play an anti-nociceptive role in peripheral nerve injury-induced neuropathic pain, which is possibly mediated by infiltrating neutrophils. PMID: 29309879
  2. Adipose stromal cells recruitment to tumours, driven by CXCL1 and CXCL8, promotes prostate cancer progression. PMID: 27241286
  3. The results demonstrate that C57BL/6J mice have a functional defect in NLRP12, impaired CXCL1 production, and that macrophages require NLRP12 expression for effective recruitment of neutrophils to inflammatory sites. PMID: 27779193
  4. GAG interactions and receptor activity of CXCL1 monomers and dimers are fine-tuned to regulate neutrophil trafficking for successful resolution of tissue injury. PMID: 27625115
  5. a paracrine role for Hippo-mediated secretion of CXCL1 and CXCL2 in the production of anti-microbial peptides (beta-defensins), iNOS, NOX2 and pro-inflammatory molecules during mycobacterial infection of the host, is reported. PMID: 27883091
  6. this study demonstrates that in vivo blocking of CXCL1 and CXCL2 can significantly reduce the Mycobacterium tuberculosis-induced bioactive IL-1beta production PMID: 28739876
  7. CXCL1 contributed to rapid neutrophil recruitment during Bacillus cereus endophthalmitis. In CXCL1-knockout mice, retinal function was greater and neutrophil influx was less than in control mice, confirming its role in ocular inflammation. PMID: 27286792
  8. Interferon-gamma (IFN-gamma) up-regulated interleukin 6 (IL-6) and CXCL1 chemokine (CXCL1) production of bone marrow mesenchymal stem cells (mBM-MSC). PMID: 28791835
  9. Our work deciphers the mCXCL1-mTORC1 pathway as crucial in liver cancer stem cell maintenance PMID: 27488521
  10. MMP7 shedding of syndecan-1/CXCL1 complexes functions as a checkpoint that restricts neutrophil activation at sites of epithelial injury. PMID: 26934670
  11. Data show that loss of loss of matrix metalloproteinase-3 (MMP-3) repressed the upregulation of the chemokines monocyte chemoattractant protein (MCP)-1 and (C-X-C motif) ligand 1 (CXCL1). PMID: 27809288
  12. The novel findings reveal the critical role of NLRP12-IL-17A-CXCL1 axis in host defense by modulating neutrophil recruitment against Klebsiella pneumoniae. PMID: 26349659
  13. Nlrp12 deficiency caused increased neutrophil migration towards the chemokine CXCL1 and the neutrophil parasite Leishmania major, revealing NLRP12 as a negative regulator of directed neutrophil migration under these conditions. PMID: 26514298
  14. Chemotactic activity of stellate cell-derived CXCL1 was assayed in vitro on neutrophils upon TLR4 activation. PMID: 27002851
  15. IL-17RA regulates CXL-1 and 5 production in the lungs during the adaptive response. PMID: 26871571
  16. Data suggest that CXCL1/IL-8, released from osteoclasts in an autoantibody-dependent manner, produces pain by activating sensory neurons. PMID: 26613766
  17. TGF-beta negatively regulates CXCL1 expression in CAFs through Smad2/3 binding to the promoter, and through suppression of HGF/c-Met autocrine signaling PMID: 26252654
  18. work shows parallel networks of necroptosis-induced CXCL1 and Mincle signalling that promote macrophage-induced adaptive immune suppression and thereby enable pancreatic ductal adenocarcinoma progression PMID: 27049944
  19. Repeated social defeat-induced VCAM-1 protein expression were localized to the vasculature of brain regions implicated in fear and anxiety responses. PMID: 25445193
  20. In a chronic-binge ethanol-feeding model, the hepatic TLR2 and TLR9-dependent MyD88-dependent pathway mediates CXCL1 production, resulting in the development of alcohol-mediated liver injury. PMID: 25930080
  21. IL-1 signaling plays a pivotal role in activating mucosal stromal cells to secrete CXCL1 which is essential for infiltration of IL-22-secreting neutrophils upon Citrobacter rodentium infection. PMID: 26034212
  22. Zfp30 is expressed in airway epithelia in the normal mouse lung and Zfp30 expression in vitro affects CXCL1 responses to an immune stimulus. PMID: 25114278
  23. Metoprolol also decreased serum levels of proinflammatory cytokines TNFalpha and CXCL1 and macrophage content in the plaques, showing that metoprolol has an anti-inflammatory effect. PMID: 25105129
  24. This study demonstrated the role of peripheral CXCL1/CXCR2 signaling in postoperative pain in the setting of prior morphine exposure. PMID: 24887006
  25. phagocytosis of refrigerator-stored RBCs in vivo induced increases in circulating monocyte chemoattractant protein-1 (MCP-1) and keratinocyte chemoattractant (KC) PMID: 25041478
  26. Neutrophil recruitment and the neutrophil cytokines, CXCL1/CXCL2, were suppressed in apo(a)transgenic mice in the abdominal aortic aneurysm model. PMID: 24650562
  27. These data identify a cytokine circuit that involves IL-1beta-induced production of CXCL1 and CXCL2 and leads the recruitment of neutrophils to streptococcal infection sites. PMID: 25114117
  28. Estrogen receptors alpha regulates CCL20/CXCL1 secretion in the female reproductive tract. PMID: 23025258
  29. These studies suggest that modulation of CXCL1 levels in tissues and blood could reduce bacterial burden in sepsis. PMID: 25172493
  30. Pharmacological inhibition of NAMPT activity mitigates inflammation in atherosclerotic plaques by reducing CXCL1-mediated activities on neutrophils. PMID: 24196571
  31. Data indicate that levels of toll-like receptors TLR4/4-stimulated chemokines CXCL1 and CXCL2 were selectively enhanced in stressed macrophages via receptor-interacting protein kinase 1 (RIPK1). PMID: 24920846
  32. findings demonstrated that CXCL1 and CXCL5 are increased in circulation with onset of T2D, are produced by islets under stress, and synergistically affect islet function, suggesting that these chemokines participate in pathogenesis of T2D. PMID: 24928936
  33. In vitro, neutrophils adherent to ICAM-1 or ICAM-2 rapidly released TNF in response to LTB4, C5a, and KC. PMID: 24913232
  34. Secretion of Cxcl1 (KC) cytokine is inhibited by electrical stimulation in early and late experimentally induced arthritic spleen. PMID: 23791889
  35. A sustained form of CXCL1 upregulation is demonstrated that can drive neuropathic pain in the spinal cord. PMID: 23831863
  36. the presence of CXCL1 is required for recurrent Herpetic stromal keratitis as evidenced by the lack of corneal disease in mice treated with anti-CXCL1 Ab. PMID: 24442436
  37. CXCL1 expressed by monocytes and CXCR2 on HBMEC is involved in monocytes migrating from blood to brain in AD patients PMID: 23967336
  38. BCG-triggered increase of lipid body biogenesis was inhibited by the PPARgamma antagonist GW9662, but not by the NF-kappaB inhibitor JSH-23. In contrast, KC/CXCL1 production was largely dependent on NF-kappaB but not on PPARgamma PMID: 24120921
  39. IL-17 and TNF-alpha synergistically mediate CXCL1 production by ATII cells after ischemia/reperfusion, via an NADPH oxidase-dependent mechanism. PMID: 24186876
  40. excessive CXCL1 expression in gp130-deficient endothelial cells augments neutrophil adhesion but hinders migration, most likely by disrupting chemotactic gradients PMID: 24081661
  41. KC, a potent neutrophil chemoattractant and an established angiogenic factor, failed to interfere in the post-infarction inflammatory response, in wound healing and scar formation after MI. PMID: 23598282
  42. Molecular basis of glycosaminoglycan heparin binding to the chemokine CXCL1 dimer. PMID: 23864653
  43. Overexpression and distinct localization of LCN2, CXCL1 and CXCL9 in the liver of fatty liver Shionogi mice suggest significant roles of these proteins in the pathogenesis of non-alcoholic steatohepatitis. PMID: 23875831
  44. At day 10, CIP treatment not only significantly reduced pro-inflammatory cytokine and chemokine concentrations, including interleukin-6 (IL-6) and KC, but it also enhanced IL-3 production compared to vehicle-treated controls. PMID: 23520506
  45. In severe S. aureus bacteraemia in mice, TNF-alpha, IL-1alpha, and KC are biomarkers predicting fatal outcome of infection. PMID: 23520553
  46. the model that mast cells, optimally positioned in close proximity to the vasculature, initiate an early phase of neutrophil recruitment by releasing the chemoattractants CXCL1/CXCL2. PMID: 23645836
  47. When expressed, CXCL1 is limited to small areas with faint staining and PCa progression does not rely on CXCL1 expression. PMID: 23334998
  48. MMP9 expressed by intestinal epithelial cells mediates inflammation in colitis with simultaneous increase in proinflammatory cytokine Kc. PMID: 23471340
  49. Early systemic release of IL-6 and keratinocyte-derived chemokine Cxcl1 may not necessarily predict an unfavorable outcome in this model of stroke. PMID: 22533966
  50. Intrahepatic CXCL1 & circulating CXCL1 were strongly induced shortly after islet infusion. Blockade of the CXCL1-CXCR1/2 axis in mice improved intrahepatic islet engraftment. The CXCR1/2-mediated pathway is a regulator of islet damage. PMID: 22996693

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Intercrine alpha (chemokine CxC) family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 322 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*